ESTScan Details for Unigene SGN-U308290

Score 
303
Direction 
Forward
Predicted Peptide Sequence 
NNGILLRHKGSPTTSPVRTVHLSPFAKKTSLNLSSTCSISGFTPVVLNRLSTVASPSQISNPQFLTIVCAKGYKMKTHKASAKRFRVSGS
GKIMRRRAGKQHLLAKKNTKRKLRLSKMVQVDQSDYNNVIGALPYLKVNRKAELELMQMGTAADA
Predicted Coding Sequence 
XXCAACAATGGTATTCTCCTTAGGCATAAAGGGTCCCCAACAACATCACCAGTCAGGACGGTTCACCTCTCTCCCTTCGCCAAGAAAACT
TCACTTAACCTCAGCTCTACTTGCAGCATTTCTGGGTTCACCCCAGTTGTGCTTAACAGGCTCTCCACTGTTGCTTCCCCCTCCCAGATC
AGTAATCCACAGTTCCTCACTATCGTCTGTGCTAAAGGCTACAAAATGAAAACCCACAAGGCTTCCGCGAAGCGGTTTCGGGTGTCTGGA
AGTGGGAAGATTATGAGGAGGAGAGCTGGGAAGCAGCATTTGTTGGCAAAGAAGAATACTAAGAGAAAATTGAGACTCTCCAAGATGGTG
CAAGTTGACCAGAGCGACTACAACAATGTAATTGGTGCTTTGCCCTATTTGAAAGTAAATCGCAAAGCXGAACTAGAGCTGATGCAGATG
GGCACTGCAGCAGATGCT
Edits in Original Sequence 
(5')XXCAACAATGGTATTCTCCTTAGGCATAAAGGGTCCCCAACAACATCAcCCAGTCAGGACGGTTCACCTCTCTCCCTTCGCCAAGA
AAACTTCACTTAACCTCAGCTCTACTTGCAGCATTTCTGGGTTCACCCCAGTTGTGCTTAACAGGCTCTCCACTGTTGCTTCCCCCTCCC
AGATCAGTAATCCACAGTTCCTCACTATCGTCTGTGCTAAAGGCTACAAAATGAAAACCCACAAGGCTTCCGCGAAGCGGTTTCGGGTGT
CTGGAAGTGGGAAGATTATGAGGAGGAGAGCTGGGAAGCAGCATTTGTTGGCAAAGAAGAATACTAAGAGAAAATTGAGACTCTCCAAGA
TGGTGCAAGTTGACCAGAGCGACTACAACAATGTAATTGGTGCTTTGCCCTATTTGAAAGTAAATCGCAAAGCXGAACTAGAGCTGATGC
AGATGGGCACTGCAGCAGATGCT(3')TTTGTTATTTTTTTTTGTACTGAAGCACGTCTTTTCTACGTAGAGGAAGTAAGCAATCCATTG
TTTGCCCTTCCCTTCCATCTTAGTTTGTATTTTATGGTCTAACCATCTACCTTATAAAAGAACTTCTGCTCGCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan