Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U308359

Score 
434
Direction 
Forward
Predicted Peptide Sequence 
VLSYCALLGALETGKWVHSYIKKKKWKLTVTLGTALMDFYAKCGCVDSAVEVFQEMPSTNVLSWTALIQGLASNGQGIRALEYYSLMQQQ
NIAPNDVTFIGVLCACTHAGLVDQGWAFFQVSTRDFGFEPRIEHCGCLVDILGRAGRIEEAYNFSQKHDPPSPMLYIGGHCWLHVDFHKN
VEIADESL
Predicted Coding Sequence 
GTGCTTTCATACTGTGCTCTTCTTGGAGCTTTAGAAACTGGAAAATGGGTACATTCCTATATTAAGAAAAAGAAGTGGAAGCTCACTGTC
ACTCTTGGGACTGCATTAATGGATTTCTATGCCAAGTGTGGCTGTGTTGATAGTGCAGTGGAAGTGTTCCAAGAGATGCCTTCAACAAAT
GTATTGTCATGGACAGCGCTAATTCAAGGTCTTGCTAGTAATGGACAAGGGATAAGGGCTCTGGAGTACTACAGTTTGATGCAGCAACAG
AACATTGCACCAAATGATGTCACATTCATTGGAGTTCTGTGTGCCTGTACTCATGCAGGCTTAGTTGATCAAGGTTGGGCTTTCTTTCAA
GTATCGACTAGAGATTTTGGCTTTGAACCCAGGATTGAACACTGTGGTTGCTTGGTTGATATTCTTGGTCGGGCAGGAAGGATTGAAGAA
GCCTACAACTTTTCTCAAAAGCATGACCCACCAAGCCCAATGCTGTATATCGGAGGACATTGTTGGCTTCATGTAGATTTTCATAAGAAT
GTTGAAATTGCTGATGAATCACTG
Edits in Original Sequence 
(5')GTGCTTTCATACTGTGCTCTTCTTGGAGCTTTAGAAACTGGAAAATGGGTACATTCCTATATTAAGAAAAAGAAGTGGAAGCTCAC
TGTCACTCTTGGGACTGCATTAATGGATTTCTATGCCAAGTGTGGCTGTGTTGATAGTGCAGTGGAAGTGTTCCAAGAGATGCCTTCAAC
AAATGTATTGTCATGGACAGCGCTAATTCAAGGTCTTGCTAGTAATGGACAAGGGATAAGGGCTCTGGAGTACTACAGTTTGATGCAGCA
ACAGAACATTGCACCAAATGATGTCACATTCATTGGAGTTCTGTGTGCCTGTACTCATGCAGGCTTAGTTGATCAAGGTTGGGCTTTCTT
TaCAAGTATCGACTAGAGATTTTGGCTTTGAACCCAGGATTGAACACTGTGGTTGCTTGGTTGATATTCTTGGTCGGGCAGGAAGGATTG
AAGAAGCCTACAACTTTTCTCAAAAGCATGACCCACCAAGCCCAATGCTGTAgTATCGGAGGACATTGTTGGCTTCATGTAGATTTTCAT
AAGAATGTTGAAATTGCTGATGAATCACTG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan