ESTScan Details for Unigene SGN-U308442

Score 
784
Direction 
Forward
Predicted Peptide Sequence 
KALRXKFEDTWQEQQPLELILGKEKKEMTGLAVGVASMKCGERSLLHVGWELGYGKQGNFSFPNVPPMADIIYEVELIGFDETKEGKARS
DMTVEERIGAADRRKMDGNDLFKEDKLAEAMQQYEMAIAYMGDDFMFQLFGKYRDMALAVKNPCHLNMAASLIKLKRFDEAIMHCSIVLS
EEENNVKALFRRGKARAELGQTDAAREDFQKARKFAPEDKAIAKELRLLAEHDKAVYQKQKELYKGLFGPRPEAQPNQSNWLVIIWHWLV
SISVTFSGVRGTRLTELIFGAC
Predicted Coding Sequence 
XXGAAAGCACTACGCXACAAGTTTGAAGATACATGGCAAGAGCAACAACCTCTTGAGTTGATTTTGGGTAAAGAGAAAAAAGAAATGACG
GGCCTGGCTGTCGGTGTTGCCAGCATGAAATGTGGTGAACGTTCTCTGTTACATGTTGGTTGGGAACTAGGGTATGGGAAACAAGGAAAC
TTTTCTTTTCCAAATGTTCCACCCATGGCAGATATTATATATGAAGTTGAGCTAATTGGCTTTGATGAAACTAAAGAAGGAAAAGCTCGT
AGCGATATGACTGTAGAGGAAAGAATCGGTGCTGCAGACAGAAGAAAGATGGATGGAAATGATTTGTTTAAAGAAGATAAATTGGCAGAG
GCTATGCAACAGTATGAAATGGCAATAGCATATATGGGAGATGACTTTATGTTTCAATTGTTTGGTAAGTACCGAGACATGGCTTTGGCA
GTAAAGAATCCCTGCCACCTTAACATGGCAGCATCTCTGATAAAGCTCAAGCGCTTTGATGAAGCCATCATGCATTGCAGCATTGTGTTG
TCTGAGGAGGAAAATAATGTCAAAGCATTGTTCAGACGAGGGAAAGCTAGAGCAGAACTTGGGCAGACAGATGCAGCTCGAGAAGATTTC
CAAAAGGCACGTAAATTTGCCCCTGAAGATAAAGCAATTGCAAAAGAGTTACGCTTGCTTGCTGAACATGACAAGGCTGTTTACCAGAAA
CAAAAGGAGCTATATAAAGGATTATTTGGACCAAGGCCAGAGGCCCAACCAAATCAAAGTAATTGGTTGGTTATAATCTGGCATTGGCTT
GTTTCAATTTCTGTCACCTTTTCAGGCGTGAGAGGCACAAGATTGACTGAATTGATCTTTGGAGCATGTTGA
Edits in Original Sequence 
(5')XXGAAAGCACTACGCXACAAGTTTGAAGATACATGGCAAGAGCAACAACCTCTTGAGTTGATTTTGGGTAAAGAGAAAAAAGAAAT
GACGGGCCTGGCTGTCGGTGTTGCCAGCATGAAATGTGGTGAACGTTCTCTGTTACATGTTGGTTGGGAACTAGGGTATGGGAAACAAGG
AAACTTTTCTTTTCCAAATGTTCCACCCATGGCAGATATTATATATGAAGTTGAGCTAATTGGCTTTGATGAAACTAAAGAAGGAAAAGC
TCGTAGCGATATGACTGTAGAGGAAAGAATCGGTGCTGCAGACAGAAGAAAGATGGATGGAAATGATTTGTTTAAAGAAGATAAATTGGC
AGAGGCTATGCAACAGTATGAAATGGCAATAGCATATATGGGAGATGACTTTATGTTTCAATTGTTTGGTAAGTACCGAGACATGGCTTT
GGCAGTAAAGAATCCCTGCCACCTTAACATGGCAGCATCTCTGATAAAGCTCAAGCGCTTTGATGAAGCCATCATGCATTGCAGCATTGT
GTTGTCTGAGGAGGAAAATAATGTCAAAGCATTGTTCAGACGAGGGAAAGCTAGAGCAGAACTTGGGCAGACAGATGCAGCTCGAGAAGA
TTTCCAAAAGGCACGTAAATTTGCCCCTGAAGATAAAGCAATTGCAAAAGAGTTACGCTTGCTTGCTGAACATGACAAGGCTGTTTACCA
GAAACAAAAGGAGCTATATAAAGGATTATTTGGACCAAGGCCAGAGGCCCAACCAAATCAAAGTAATTGGTTGGTTATAATCTGGCATTG
GCTTGTTTCAATaTTCTGTCACCTTTTCAGGCGTGAGAGGCACAAGATTGACTGAATTGATCTTTGGAGCATGTTGA(3')AATTTTCTT
GTTTATGAAGTCAATTAAATCTGTTAGTGGTCAATTGACTTCTTCATGCATTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan