ESTScan Details for Unigene SGN-U308502

Score 
173
Direction 
Forward
Predicted Peptide Sequence 
GKGSNATGAGGFDQAFVTFGWSAGDTDDRGWTPLHICARKGASQGGETLLKEGMDVHVAARGPTSHGVTPLHLAAKGGHLKVMDELLX
Predicted Coding Sequence 
GGCAAAGGAAGTAATGCCACAGGAGCAGGAGGGTTCGATCAGGCGTTTGTGACATTTGGATGGTCTGCAGGGGATACAGATGATCGAGGT
TGGACTCCGCTTCATATTTGTGCAAGGAAAGGCGCATCTCAAGGAGGTGAAACACTTCTCAAGGAAGGAATGGATGTACATGTGGCTGCA
CGGGGGCCAACATCACATGGTGTTACCCCTCTCCATCTTGCAGCCAAGGGTGGCCATCTCAAAGTGATGGATGAATTGCTTGAX
Edits in Original Sequence 
GCTTTGATCCTCGTGATTGCTCCTAGATTTGCTTGTTTGGTGGTGACGAACGTCTGATTTGGAGAAAGAGTGTTGAATTTGGGTCGTGGT
ACTGTTGGTGGTAAAATTTGTAGGATTTAGTGGAATACTTGTATGTATAGTGGTATTCCAATTGAAAACTGTTTTGTAGAGGAAA
(5')G
GCAAAGGAAGTAATGCCACAGGAGCAGGAGGGTTCGATCAGGCGTTTGTGACATTTGGATaGGTCTGCAGGGGATACAGATGATCGAGGT
TGGACTCCGCTTCATATTTGTGCAAGGAAAGGCGCATCTCAAGGAGGTGAAACgACTTCTCAAGGAAGGAATGGATGTACATGTGGCTGC
ACGGGGGCCAACATCACATGGTGTTACCCCTCTCCATCTTGCAGCCAAGGGTGGCCATCTCAAAGTGATGGATGAATTGCTTGAX(3')A
CCAAGGTGCTGACATTGATGCACGCACTAAGGGTGCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan