ESTScan Details for Unigene SGN-U308680

Score 
178
Direction 
Forward
Predicted Peptide Sequence 
RGSFLVQQALRAFRANNLESAKSRLSLCADDIREQLQRIGNTAELCSQLGAVLGMLGDCCRASGDAASAITYFDESVVFLSKVPKDDLEV
THTLSVSLNKIGDLKYYDGDLQAARSYYFQALDVRRDAIKRHSSIPSQILDIAISLAKVADVDRNLGX
Predicted Coding Sequence 
XAGCGTGGTTCTTTCTTGGTGCAACAAGCCTTGAGGGCATTTCGTGCAAATAATTTAGAAAGTGCAAAATCAAGACTTAGTCTGTGTGCT
GACGACATCAGAGAGCAGTTGCAACGAATTGGGAACACTGCTGAATTGTGCTCACAGCTAGGAGCAGTTTTGGGCATGCTTGGTGATTGC
TGTCGTGCTAGCGGAGATGCCGCCTCTGCTATCACTTATTTTGATGAGAGTGTTGTATTCCTTTCAAAAGTGCCTAAAGATGATTTGGAG
GTTACGCATACTCTATCTGTATCACTTAATAAAATTGGAGATCTGAAATATTATGATGGGGACCTGCAAGCTGCCAGATCTTATTATTTC
CAGGCTCTGGATGTTCGTCGTGATGCTATCAAGCGTCATTCTAGCATTCCATCACAGATTTTGGATATAGCTATTTCCCTTGCAAAAGTT
GCAGACGTGGACAGAAATCTAGGAAAX
Edits in Original Sequence 
(5')XAGCGTGGTTCTTTCTTGGTGCAACAAGCCTTGAGGGCATTTCGTGCAAATAATTTAGAAAGTGCAAAATCAAGACTTAGTCTGTG
TGCTGACGACATCAGAGAGCAGTTGCAACGAATTGGGAACACTGCTGAATTGTGCTCACAGCTAGGAGCAGTTTTGGGCATGCTTGGTGA
TTGCTGTCGTGCTAGCGGAGATGCCGCCTCTGCTATCACTTATTTTGATGAGAGTGTTGTATTCCTTTCAAAAGTGCCTAAAGATGATTT
GGAGGTTACGCATACTCTATCTGTATCACTTAATAAAATTGGAGATCTGAAATATTATGATGGGGACCTGCAAGCTGCCAGATCTTATTA
TTTCCAGGCTCTGGATGTTCGTCGTGATGCTATCAAGCGTCATTCTAGCATTCCATCACAGATTTTGGATATAGCTATTTCCCTTGCAAA
AGTTGCAGACGTGGACAGAAATCTAGGAAAX(3')A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan