ESTScan Details for Unigene SGN-U308683

Score 
540
Direction 
Forward
Predicted Peptide Sequence 
MDGNKDEALRCIGIANEAIASGNKQRALKFIKIAQRLNHSLSVDDLLAACEDLDSSSASPSSTVSSSNHVRNEEGGVKVDGVSNGERTYT
EEHVQLVKKIKSKKDYYAVLGVEKNCSVEEIKKAYKKLSLKVHPDKNKAPGSEDAFKKVSKAFKCLSEDDSRRQYDETGLVEEFEHNQQY
NVRRRRRTTGYGIYEDDFDPDEIFRAFFGQNDMFRTAHVYRT
Predicted Coding Sequence 
ATGGATGGGAATAAAGATGAGGCTTTAAGGTGCATTGGCATTGCCAACGAGGCAATTGCGTCAGGGAATAAGCAAAGGGCCCTAAAATTT
ATCAAGATTGCGCAGCGATTAAATCACTCTTTATCGGTGGACGACCTGTTGGCTGCTTGTGAGGATCTTGATTCGTCGTCTGCTAGTCCT
TCAAGTACTGTGTCGAGCAGCAATCATGTGAGAAATGAGGAGGGTGGGGTTAAGGTTGATGGGGTTTCAAACGGGGAGAGGACTTATACG
GAAGAGCATGTCCAATTGGTTAAGAAGATAAAGAGTAAGAAGGACTATTATGCAGTTCTTGGTGTGGAGAAGAATTGTTCGGTTGAGGAG
ATTAAGAAGGCATACAAGAAACTGTCATTGAAGGTTCATCCTGATAAGAATAAGGCTCCAGGTTCAGAGGATGCATTTAAGAAGGTTAGC
AAGGCGTTTAAGTGTTTGAGTGAGGATGACTCGAGGAGACAGTATGATGAAACTGGTTTGGTTGAGGAATTTGAGCATAATCAGCAGTAT
AATGTGAGACGGCGGAGAAGAACAACTGGGTATGGCATTTATGAAGATGATTTTGATCCAGATGAGATTTTTAGGGCCTTTTTTGGTCAG
AATGACATGTTCAGGACAGCTCATGTTTACCGAACC
Edits in Original Sequence 
GAGAACATTGGGGTTGAATTTAATGGCCGTATCTTGAGTTAAATTGTTGAATTTTGAAGTGGGTTTTTCAAGGTCAT(5')ATGGATGGG
AATAAAGATGAGGCTTTAAGGTGCATTGGCATTGCCAACGAGGCAATTGCGTCAGGGAATAAGCAAAGGGCCCTAAAATTTATCAAGATT
GCGCAGCGATTAAATCACTCTTTATCGGTGGACGACCTGTTGGCTGCTTGTGAGGATCTTGATTCGTCGTCTGCTAGTCCTTCAAGTACT
GTGTCGAGCAGCAATCATGTGAGAAATGAGGAGGGTGGGGTTAAGGTTGATGGGGTTTCAAACGGGGAGAGGACTTATACGGAAGAGCAT
GTCCAATTGGTTAAGAAGATAAAGAGTAAGAAGGACTATTATGCAGTTCTTGGTGTGGAGAAGAATTGTTCGGTTGAGGAGATTAAGAAG
GCATACAAGAAACTGTCATTGAAGGTTCATCCTGATAAGAATAAGGCTCCAGGTTCAGAGGATGCATTTAAGAAGGTTAGCAAGGCGTTT
AAGTGTTTGAGTGAGGATGACTCGAGGAGACAGTATGATGAAACTGGTTTGGTTGAGGAATTTGAGCATAATCAGCAGTATAATGTGAGA
CGGCGGAGAAGAACAACTGGGTATGGCATTTATGAAGATGATTTTGATCCAGATGAGATTTTTAGGGCCTTTTTTGGTCAGAATGACATG
TTCAGGACAGCTCATGTTTACCGAACC(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan