ESTScan Details for Unigene SGN-U308775

Score 
432
Direction 
Forward
Predicted Peptide Sequence 
SAPGSAPGSPKNRVKFLCSHGGKILPRPADGHLKYVGGETRVISVSRDIKFSEXYEEAHIPDRRRDGAQISVGPGGLDALVSVKTDEDLK
HMFSEHDRYESAGSPRLRAFLFPANPVVVENYMDAIAVEQRYIDAINGIVRAPPSSGTKLHHPTLTVHPAPGPSLGISSACSSPRSPESC
NTDGNAHEXHAPEQLSQHPNAYAQGPELTYFCNLTTGLQQQNSASGLQLYPQITTKPSGKAFTRAINIL
Predicted Coding Sequence 
XGTTCAGCACCAGGGTCTGCCCCTGGTTCCCCAAAGAATAGGGTCAAGTTTCTGTGCAGCCATGGTGGCAAAATCCTTCCCAGGCCGGCA
GATGGTCACCTCAAATATGTTGGGGGCGAGACCCGCGTCATCTCTGTCTCTCGAGATATCAAATTCTCAGAAXCTTATGAAGAAGCTCAC
ATACCTGATCGAAGAAGAGATGGTGCTCAAATATCAGTTGGTCCAGGAGGACTTGATGCCCTGGTTTCGGTGAAGACTGATGAGGACCTG
AAGCACATGTTCAGCGAACATGACCGGTATGAAAGTGCAGGGTCCCCGAGGCTTCGAGCCTTCCTCTTCCCGGCAAACCCTGTTGTGGTG
GAGAATTACATGGACGCTATTGCGGTCGAGCAGCGATACATTGATGCGATCAATGGCATTGTTCGCGCCCCGCCCTCATCAGGCACTAAG
CTGCATCACCCAACTCTCACTGTACATCCTGCCCCTGGGCCTTCCTTAGGCATATCTTCTGCCTGCTCTTCCCCAAGATCACCTGAGAGC
TGCAACACCGATGGAAATGCCCATGAACXCCATGCTCCAGAGCAGCTATCACAGCACCCGAATGCATATGCACAGGGTCCAGAGCTCACC
TACTTCTGCAACCTTACTACTGGTCTTCAGCAGCAGAACAGTGCTTCCGGTCTTCAGCTGTATCCTCAGATTACTACCAAACCATCAGGC
AAGGCTTTCACCAGGGCTATCAATATCCTA
Edits in Original Sequence 
(5')XGTTCAGCACCAGGGTCTGCCCCTGGTTCCCCAAAGAATAGGGTCAAGTTTCTGTGCAGCCATGGTGGCAAAATCCTTCCCAGGCC
GGCAGATGGTCACCTCAAATATGTTGGGGGCGAGACCCGCGTCATCTCTGTCTCTCGAGATATCAAATTCTCAGAAXCTTATGAAGAAGC
TCACATACCTGATCGAAGAAGAGATGGTGCTCAAATATCAGTTGGTCCAGGAGGAtCTTGATGCCCTGGTTTCGGTGAAGACTGATGAGG
ACCTGAAGCACATGTTCAGCGAACATGACCGGTATGAAAGTGCAGGGTCCCCGAGGCTTCGAGCCTTCCTCTTCCCGGCAAACCCTGTTG
TGGTGGAGAATTACATGGACGCTATTGCGGTCGAGCAGCGATACATTGATGCGATCAATGGCATTGTTCGCGCCCCGCCCTCATCAGGCA
CTAAGCTGCATCACCCAACTCTCACTGTACATCCTGCCCCTGGGCCTTCCTTAGGCATATCTTCTGCCTGCTCTTCCCCAAGATCACCTG
AGAGCTGCAACACCGATGGAAATGCCCATGAACXCCATGCTCCAGAGCAGCTATCACAGCACCCGAATGCATATGCACAGGGTCCAGAGC
TCACCTACTgTCTGCAACCTTACTACTGGTCTTCAGCAGCAGAACAGTGCTTCCGGTCTTCAGCTGTATCCTCAGaATTACTACCAAACC
ATCAGGCAAGGCTTTCACCAGGGCTATCAATATCCTA(3')AGCAAACCACCTGCTGATGGCCATAAATGTGCGGGACCGGGAAAGGCTG
ATCTCGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan