ESTScan Details for Unigene SGN-U308839

Score 
196
Direction 
Forward
Predicted Peptide Sequence 
SACPTLSTDAAYALGVRVAAILHSSRPIRIRIHEKSTNKEFQKKEELLXFPSEFQIDTNIRLTKAESRVLNFGNXISSPMGEMKMEELSL
PALFEQARKIHLAACESTVDQETLKKGCENLAQCEEMISKLGLFSTNETKDDISTTNLKYLLVLFYLGELTEKVAQDDRIQVLKVSQAKL
KEFISFCEAMELVPEEELQMSSSGGANSFADLRAKKVARFRRQKAA
Predicted Coding Sequence 
XXTTCGGCATGTCCAACTCTTTCAACCGACGCTGCCTACGCACTAGGCGTACGAGTTGCCGCGATCCTCCACTCTTCCCGACCTATTCGT
ATCAGAATACACGAGAAAAGCACAAATAAGGAATTTCAAAAGAAAGAGGAGCTCCTTCXTTTCCCTTCCGAATTCCAGATTGATACAAAT
ATTAGGCTAACTAAAGCAGAGTCTAGGGTTTTGAATTTCGGTAATTGAATAAGTTCACCTATGGGTGAAATGAAGATGGAGGAGTTGTCT
TTGCCAGCTCTTTTCGAGCAGGCTCGAAAGATTCATCTCGCCGCCTGCGAATCAACAGTTGATCAGGAGACCCTGAAAAAAGGTTGTGAA
AATTTGGCGCAGTGCGAGGAAATGATTAGTAAATTAGGACTCTTCTCGACAAATGAGACCAAGGATGACATTAGCACCACTAATCTCAAG
TATCTTCTCGTGCTGTTCTATCTTGGTGAGTTGACAGAAAAAGTTGCGCAAGATGACAGGATACAGGTTCTCAAGGTTTCTCAAGCTAAG
CTAAAGGAATTTATTTCGTTTTGTGAAGCCATGGAGCTTGTGCCTGAAGAAGAGTTACAAATGTCCTCTTCAGGGGGTGCTAATTCTTTT
GCTGACCTTAGAGCAAAAAAGGTTGCTCGTTTTAGACGGCAGAAAGCTGCX
Edits in Original Sequence 
(5')XXTTCGGCATGTCCAACTCTTTCAACCGACGCTaGCCTACGCACTAGGCGTACGAGTTGCCGCGATCCTCCACTCTgTCCCGACCT
ATTCGTATCAGAATACACGAGAAAAGCACAAATAAGGAATTTCAAAAGAAAGAGGAGCTCCTTCXTTTCCCTTCCGAATTCCAGATTGAT
ACAAATATTAGGCTAACTAAAGCAGAGTCgTAGGGTTTTGAATTTCGGTAATTGAATAAGTTCACCTATGGGTGAAATGAAGATGGAGGA
GTTGTCTTTGCCAGCTCTTTTCGAGCAGGCTCGAAAGATTCATCTCGCCGCCTGCGAATCAACAGTTGATCAGGAGACCCTGAAAAAAGG
TTGTGAAAATTTGGCGCAGTGCGAGGAAATGATTAGTAAATTAGGACTCTTCTCGACAAATGAGACCAAGGATGACATTAGCACCACTAA
TCTCAAGTATCTTCTCGTGCTGTTCTATCTTGGTGAGTTGACAGAAAAAGTTGCGCAAGATGACAGGATACAGGTTCTCAAGGTTTCTCA
AGCTAAGCTAAAGGAATTTATTTCGTTTTGTGAAGCCATGGAGCTTGTGCCTGAAGAAGAGTTACAAATGTCCTCTTCAGGGGGTGCTAA
TTCTTTTGCTGACCTTAGAGCAAAAAAGGTTGCTCGTTTTAGACGGCAGAAAGCTGCX(3')GCTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan