ESTScan Details for Unigene SGN-U308992

Score 
232
Direction 
Reverse
Predicted Peptide Sequence 
MNKRIGFGETGNKPLAPRQKYHQSPKILWFNQNCHLLKKNAEASKPDSKSQAADDTSARELVSSQFEQLHFLRNELRFYVDLLQALNNVS
NPKINAAWITSPHSFPFPTASTSCFSRFRDVQEPSKTTSPSAX
Predicted Coding Sequence 
ATGAACAAAAGAATTGGTTTCGGGGAAACTGGTAATAAGCCTTTAGCTCCTCGTCAAAAATACCACCAATCCCCCAAAATTCTATGGTTT
AACCAAAACTGTCATCTACTCAAGAAAAATGCAGAGGCTAGCAAACCAGACTCCAAATCACAAGCTGCAGATGATACTTCTGCACGAGAA
CTCGTTAGCTCTCAATTCGAACAGCTCCATTTTCTGAGAAATGAACTTAGGTTTTATGTTGACTTGCTCCAGGCACTGAATAACGTCTCC
AACCCGAAAATCAATGCAGCCTGGATTACTAGTCCACACTCGTTTCCTTTCCCAACTGCATCAACGTCATGCTTCTCCCGTTTCAGAGAC
GTACAAGAACCTTCAAAAACAACTTCACCCTCTGCCGXX
Edits in Original Sequence 
TTTATTGTTCCCATATATCCCCTAGTACACTTGACATGCTTTCAAAATGACTAATTCGATGCGAGTTCTCCTATTGAGTTTGGTTTCTTC
TTCAACAGAAA
(5')ATGAACAAAAGAATTGGTTTCGGGGAAACTGGTAATAAGCCTTTAGCTCCTCGTCAAAAATACCACCAATCCCCC
AAAATTCTATGGTTTAACCAAAACTGTCATCTACTCAAGAAAAATGCAGAGGCTAGCAAACCAGACTCCAAATCACAAGCTGCAGATGAT
ACTTCTGCACGAGAACTCGTTAGCTCTCAATTCGAACAGCTCCATTTTCTGAcGAAATGAACTTAGGTTTTATGTTGACTTGCTCCAGGC
ACTGAATAACGTCTCCAACCCGAAAATCAATGCAGtCCTGGATTACTAGTCCACACTCGTTTCCTTTCCCAACTGCATCAACGTCATGCT
TCTCCCGTTTCAGAGACGTACAAGAACCTTCAAAAACAACTTCACCCTCTGCCGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan