ESTScan Details for Unigene SGN-U309172

Score 
1020
Direction 
Forward
Predicted Peptide Sequence 
PDLLNKALLRPGRFDRQISIDNPDIKGREQIFQIYLKKIKLDQEPSYYSQRLAALTPGFAGADIANVCNEAALIAARTEETQVKMEHFDA
AIDRIIGGLEKKNKVISKLERRTVAYHESGHAVVGWFLEHAEPLLKVTIVPRGTAALGFAQYVPNENLLMTKEQLFDMTCMTLGGRAAKQ
VLLGKISTGAQNDLEKVTKMTYAQVAVYGFSEKVGLLSFPQRDEFEMTRPYGSKTAAIIDAEVREWVGKAYNRTVELIEEHKERVAKIAE
LL
Predicted Coding Sequence 
XXACCTGATCTTTTAAACAAAGCCTTGTTAAGGCCTGGTCGATTTGATCGACAAATTAGCATAGATAACCCTGACATCAAAGGTCGTGAA
CAGATATTTCAAATCTACTTGAAAAAGATCAAACTTGATCAGGAGCCATCCTATTATTCACAGAGACTTGCTGCCCTTACTCCTGGATTT
GCTGGTGCGGATATTGCAAATGTTTGTAATGAAGCTGCTTTGATTGCTGCAAGGACCGAGGAAACACAGGTGAAAATGGAACATTTTGAT
GCAGCCATAGATAGAATAATTGGTGGTCTGGAGAAGAAAAACAAGGTCATCAGCAAACTTGAACGCCGTACTGTAGCTTACCATGAATCT
GGTCATGCTGTTGTTGGCTGGTTTCTAGAACATGCAGAACCCTTGTTGAAGGTAACAATTGTTCCTCGTGGTACTGCAGCACTTGGCTTT
GCTCAGTATGTCCCCAATGAGAACCTTCTTATGACAAAGGAACAACTTTTTGACATGACATGCATGACTCTTGGTGGTCGTGCTGCAAAA
CAGGTTCTGTTGGGTAAAATATCAACCGGAGCCCAGAATGACCTGGAAAAAGTGACAAAAATGACATATGCCCAAGTTGCTGTCTATGGT
TTTAGCGAGAAGGTGGGTCTTCTTTCTTTTCCTCAGAGGGATGAATTTGAGATGACCAGACCTTATGGTAGCAAGACCGCAGCAATTATA
GATGCTGAAGTACGTGAATGGGTTGGCAAGGCTTATAACCGAACTGTTGAACTGATTGAGGAACACAAGGAGCGTGTAGCTAAAATTGCT
GAACTGTTG
Edits in Original Sequence 
(5')XXACCTGATCTTTTAAACAAAGCCTTGTTAAGGCCTGGTCGATTTGATCGACAAATTAGCATAGATAACCCTGACATCAAAGGTCG
TGAACAGATATTTCAAATCTACTTGAAAAAGATCAAACTTGATCAGGAGCCATCCTATTATTCACAGAGACTTGCTGCCCTTACTCCTGG
ATTTGCTGGTGCGGATATTGCAAATGTTTGTAATGAAGCTGCTTTGATTGCTGCAAGGACCGAGGAAACACAGGTGAAAATGGAACATTT
TGATGCAGCCATAGATAGAATAATTGGTGGTCTGGAGAAGAAAAACAAGGTCATCAGCAAACTTGAACGCCGTACTGTAGCTTACCATGA
ATCTGGTCATGCTGTTGTTGGCTGGTTTCTAGAACATGCAGAACCCTTGTTGAAGGTAACAATTGTTCCTCGTGGTACTGCAGCACTTGG
CTTTGCTCAGTATGTCCCCAATGAGAACCTTCTTATGACAAAGGAACAACTTTTTGACATGACATGCATGACTCTTGGTGGTCGTGCTGC
AAAACAGGTTCTGTTGGGTAAAATATCAACCGGAGCCCAGAATGACCTGGAAAAAGTGACAAAAATGACATATGCCCAAGTTGCTGTCTA
TGGTTTTAGCGAGAAGGTGGGTCTTCTTTCTTTTCCTCAGAGGGATGAATTTGAGATGACCAGACCTTATGGTAGCAAGACCGCAGCAAT
TATAGATGCTGAAGTACGTGAATGGGTTGGCAAGGCTTATAACCGAACTGTTGAACTGATTGAGGAACACAAGGAGCGTGTAGCTAAAAT
TGCTGAACTGTTG(3')GCTTAAGAAAGAGGTTCTTCATCAAGATGACTTGGTCCAAGTACTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan