ESTScan Details for Unigene SGN-U309184

Score 
302
Direction 
Forward
Predicted Peptide Sequence 
LSSSSRCSFVLRIXAAVGSGLDDSSYLQLFPVVVPVSLGRTLFNALPLLPITHGIKCNDLYAFVIGSYVIWTAVAGARYSIEQIRTNRAT
ILFKQIWKWCGIVIKSTALLSIWIFVIPVLIGLLFELLVIVPMRVPVNESPVFLLYHDWALGLIFL
Predicted Coding Sequence 
CTTTCATCTTCCAGTAGGTGCAGCTTTGTGCTTCGAATTGXTGCTGCTGTTGGTAGTGGCTTGGATGACTCTTCTTATCTTCAACTCTTC
CCTGTTGTTGTGCCTGTTTCACTTGGTCGAACACTTTTCAATGCCCTTCCACTTCTCCCAATAACACATGGAATAAAGTGCAATGACTTG
TATGCTTTTGTAATTGGAAGTTATGTCATTTGGACTGCTGTGGCTGGAGCAAGGTACTCAATTGAGCAGATAAGAACAAATAGGGCTACA
ATTTTGTTTAAGCAAATTTGGAAATGGTGTGGGATCGTGATTAAGAGTACTGCATTGTTATCAATATGGATTTTTGTCATTCCTGTTTTA
ATTGGACTGCTTTTCGAGCTCTTGGTGATTGTACCAATGCGAGTGCCCGTGAATGAAAGTCCAGTTTTCCTTTTGTATCACGATTGGGCC
CTTGGATTGATCTTTCTT
Edits in Original Sequence 
(5')CTTTCATCTTCCAGTAGGTGCAGCTTTGTGCTTCGAATTGXTGCTGCTGTTGGTAGTGGCTTGGATGACTCTTCTTATCTTCAACT
CTTCCCTGaTTGTTGTGCCTGTTTCACTTGGTCGAACACTTTTCAATGCCCTTCCACTTCTCCCAATAACACATGGAATAAAGTGCAATG
ACTTGTATGCTTTTGTAATTGGAAGTTATGTCATTTGGACTGCTGTGGCTGGAGCAAGGTACTCAATTGAGCAGATAAGAACAAATAGGG
CTACAATTTTGTTTAAGCAAATTTGGAAATGGTGTGGGATCGTGATTAAGAGTACTGCATTGTTATCAATATGGATTTTTGTCATTCCTG
TTTTAATTGGACTGCTTTTCGAGCTCTTGGTGATTGTACCAATGCGAGTGCCCGTGAATGAAAGTCCAGTTTTCCTTTTGTATCACGATT
GGGCCCTTGGATTGATCTTTCTT(3')TAAGATTTGGACTAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan