ESTScan Details for Unigene SGN-U309196

Score 
104
Direction 
Forward
Predicted Peptide Sequence 
MFWVKSLIGLYLRILIYSFLSRGVXSIHLTHVAFSPNSEEVLLSYSGEHVYLMDVNPATGSSMRYTVGDITKLTSFAPILNGVELQQSFP
RVCSNGSSKGHVAARLDKCRKLIQFAGKSLKGETSSYDGIEACNEVLX
Predicted Coding Sequence 
ATGTTTTGGGTTAAGAGTCTTATAGGTCTATACCTGCGAATTCTGATTTACTCGTTTTTGTCCAGGGGCGTTXCTAGCATACATCTAACC
CACGTCGCCTTTAGCCCCAATTCTGAGGAGGTTCTTCTCAGTTATAGTGGGGAGCATGTATACCTGATGGATGTAAATCCCGCAACTGGA
AGTAGTATGCGGTACACGGTAGGAGATATCACAAAACTGACAAGCTTTGCTCCCATACTCAATGGAGTGGAATTGCAACAGTCATTTCCT
CGTGTCTGCTCTAATGGATCTAGTAAAGGCCATGTTGCTGCTAGGCTTGACAAGTGCAGAAAACTGATCCAGTTTGCTGGAAAATCACTG
AAGGGTGAAACAAGCTCTTATGATGGAATTGAGGCTTGTAATGAAGTTTTGGXX
Edits in Original Sequence 
AGGGATCTATTCATAGACGAAAGTAATATTTTGATAGTTTTTTTTTGGGGGACAGTTATTG(5')ATGTTTTGGGTTAAGAGTCTTATAG
GTCTATACCTGCGAATTCTGATTTACTCGTTTTTGTCCAGGGGCGTTXCTAGCATACATCTAACCCACGTCGCCTTTAGCCCCAATTCTG
AGGAGGTTCTTCTCAGTTATAGTGGGGAGCATGTATACCTGATGGATGTAAATCCCGCAACTGGAAGTAGTATGCGGTACACGGTAGGAG
ATATCACAAAACTGACAAGCTTTGCTCCCATACTCAATGGAGTGGAATTGCAACAGTCATTTCCTCGTGTCTGCTCTAATGGATCTAGTA
AAGGCCATGTTGCTGCTAGGCTTGACAAGTGCAGAAAACTGATCCAGTTTGCTGGAAAATCACTGAAGGGTGAAACAAGCTCTTATGATG
GAATTGAGGCTTGTAATGAAGTTTTGGXX(3')TTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan