ESTScan Details for Unigene SGN-U309235

Score 
175
Direction 
Forward
Predicted Peptide Sequence 
DCEPNVVTYSILIXLPVPDGKLDESLNLLRVMKDKGLNPDTYTYDPLISAFCREGRTDLALEFMDYMICNGCLPDIVNYNTILSAMCKNG
NANQALELFGDLPQMGCPPDGGQAVAMATAHSLLKKNAITKEAFKRLNRIFPKLDEDLSLAKK
Predicted Coding Sequence 
XXAGATTGCGAACCCAATGTGGTTACCTACAGCATCCTGATTAGXTTGCCTGTGCCAGATGGAAAATTGGACGAGTCACTTAACTTGCTG
AGGGTCATGAAAGACAAGGGTCTAAATCCTGACACGTACACGTATGATCCGTTGATTTCTGCATTCTGCAGAGAAGGAAGGACGGATTTG
GCACTTGAATTCATGGATTATATGATTTGCAATGGTTGCCTACCTGATATAGTGAACTACAACACTATACTATCTGCTATGTGCAAGAAT
GGAAATGCTAATCAGGCCTTGGAACTATTTGGAGATCTTCCACAAATGGGTTGTCCTCCCGATGGTGGXCAAGCTGTGGCTATGGCGACA
GCACACTCTCTTCTGAAAAAGAACGCTATCACAAAAGAAGCGTTCAAACGTTTGAACAGAATCTTTCCTAAGCTTGATGAAGATCTATCT
CTCGCAAAGAAGTAG
Edits in Original Sequence 
(5')XXAGATTGCGAACCCAATGTGGTTACCTACAGCATCCTGATTAGXTTGCCTGTGCCgAGATGGAAAATTGGACGAGTCACTTAACT
TGCTGAGGGTCATGAAAGACAAGGGTCTAAATCCTGACACGTACACGTATGATCCGTTGATTTCTGCATTCTGCAGAGAAGGAAGGACGG
ATTTGGCACTTGAATTCATGGATTATATGATTTGCAATGGTTGCCTACCTGATATAGTGAACTACAACACTATACTATCTGCTATGTGCA
AGAATGGAAATGCTAATCAGGCCTTGGAACTATTTGGAGATCTTCCACAAATGGGTTGTCCTCCCGATGGTGGXCAAGCTGTGGCTATGG
CGACAGCACACTCTCTTCTGAAAAAGAACGCTATCACAAAAGAAGCGTTCAAACGTTTGAACAGAATCTTTCCTAAGCTTGATGAAGATC
TATCTCTCGCAAAGAAGTAG(3')GGTTGGTGTGATCTGTTGGTCGCTGGATTTCGTCTTTGGAATGTGTCCATAAAAATCTTGTATTGC
ATCAAGCGAGAAAATCTAGTTTCTTGTATGCTTCCTCTCTGTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan