ESTScan Details for Unigene SGN-U309299

Score 
102
Direction 
Forward
Predicted Peptide Sequence 
LATGSMDKTVKLWDLSNNQPSCVASKNPKAGAVFSVSFSDECPFLLAIGGSKGKLELWETLSDAAVSTKYGKYTNQKDQPSRDSRIVDLI
FRATKELWHIFADYXQFYFMIQLEYHCNYLFLSRRNDEWNSSRMQIGRGVKVEKFRFRIEFGISEFGIEFSNFDFDQNIFFEIGITDFKV
GIXKSEL
Predicted Coding Sequence 
CTTGCAACTGGTTCCATGGATAAAACGGTAAAACTCTGGGATTTGTCCAACAATCAACCTTCGTGTGTGGCCTCGAAAAATCCAAAAGCT
GGAGCTGTCTTTTCTGTTTCATTCTCCGATGAATGCCCCTTTCTGCTAGCCATTGGTGGATCTAAGGGAAAATTGGAATTATGGGAGACT
CTATCGGATGCTGCAGTTTCTACTAAATATGGAAAATACACTAATCAGAAAGATCAGCCCAGTCGTGACTCGAGGATTGTGGATTTGATA
TTTCGGGCXACAAAAGAGTTGTGGCATATATTTGCTGATTACXGGCAGTTCTATTTCATGATCCAATTGGAATACCACTGTAACTATCTC
TTCTTGTCTAGGAGGAATGATGAGTGGAATTCATCACGTATGCAGATAGGTAGGGGTGTCAAAGTCGAAAAATTCCGATTTCGAATTGAA
TTCGGAATTTCGGAATTTGGAATTGAATTCAGTAATTTTGATTTCGACCAAAATATATTTTTTGAAATCGGAATTACCGATTTCAAAGTA
GGAATTCXGAAATCGGAACTGTGA
Edits in Original Sequence 
(5')CTTGCAACTGGTTCCATGGATAAAACGGTAAAACTCTGGGATTTGTCCAACAATCAACCTTCGTGTGTGGCCTCGAAAAATCCAAA
AGCTGGAGCTGTCTTTTCTGTTTCATTCTCCGATGAATGCCCCTTTCTGCTAGCCATTGGTGGATCTAAGGGAAAATTGGAATTATGGGA
GACTCTATCGGATGCTGCAGTTTCTACTAAATATGGAAAATACACTAATCAGAAtAGATCAGCCCAGTCGTGACTCGAGGATTGTGGATT
TGATATTTCGGGCXACAAAAGAGTTGTGGCATATATTTGCTGATTACXGGCAGTTCTATTTCATGATCCAATTGGAATACCACTGTAACT
ATCTCTTCTTGTCTAGGAGGAATGATGAGTGGAATTCATCACGTATGCAGATAGGTAGGGGTGTgCAAAGTCGAAAAATTCCGATTTCGA
ATTGAATTCGGAATTTCGGtAATTTGGAATTGAATTCAGTAATTTTGATTTCGACCAAAATATATTTTTTGAAATCGGAATTACCGATTT
CAAAGTAGGAATTCXGAAATCGGAACTGTGA(3')ATTTCGATTTTGTTTGATAATATGTATATATATAATATAATATTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan