Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U309302

Score 
294
Direction 
Reverse
Predicted Peptide Sequence 
LKDYNALGGENNFRQKLRQSVWQSTGIFSVFRVSVQLKMNGFLFIHTCPMGXVASRLKDHVHGRPVLDWSRRKKIALGTARGLVYLHEQC
DPKIIHRDVKAANILLDEDFEAVVGDFGLAKLLDHRESHVTTAVRGTVGHIAPEYLSTGQSSEKTDVFGFGILLLELITGQKALDFGRGA
KQKGIMLDWESFFLFQACIAQTAFLNXLQLGLSEXHTNVITVCLSKDMMRLADVPLKQMILVPSTQAFEFFVPIDFVPSKGIIKLKQWTS
RLFV
Predicted Coding Sequence 
XGATTAAAGGACTACAATGCTCTTGGTGGTGAAAACAATTTCAGACAGAAGTTGAGACAATCAGTTTGGCAGTCCACCGGAATCTTCTCC
GTCTTTCGGGTTTCTGTTCAACTGAAAATGAACGGCTTCTTGTTTATCCATACATGCCCAATGGGAGXTGTAGCATCTAGATTAAAAGAT
CATGTCCATGGTAGGCCTGTTCTAGACTGGTCGAGGCGGAAAAAGATTGCTTTAGGTACAGCAAGAGGGCTGGTGTATTTGCATGAGCAG
TGTGACCCCAAAATTATTCATCGAGACGTCAAGGCTGCAAATATTCTGTTGGATGAAGACTTTGAGGCGGTTGTTGGAGATTTTGGGTTG
GCAAAGCTCTTGGATCACCGGGAATCTCATGTAACCACTGCTGTCCGTGGCACTGTTGGTCATATTGCTCCTGAGTATCTGTCTACTGGC
CAGTCATCAGAAAAGACTGATGTTTTTGGTTTTGGGATCTTACTTCTTGAGTTAATAACAGGCCAGAAGGCGTTGGATTTTGGGCGGGGA
GCCAAGCAGAAAGGCATAATGCTTGACTGGGAGTCTTTCTTTCTCTTCCAAGCTTGCATTGCACAAACTGCTTTTCTAAATGXTCTTCAA
CTCGGGTTAAGTGAGXTGCACACCAATGTGATCACTGTGTGTTTAAGTAAAGATATGATGCGTCTTGCAGATGTACCACTXAAACAGATG
ATACTTGTTCCATCGACACAGGCTTTTGAGTTCTTCGTCCCCATAGATTTTGTTCCTAGCAAAGGCATTATTAAATTGAAACAATGGACA
AGTAGATTGTTTGTG
Edits in Original Sequence 
(5')XGATTAAAGGACTACAATGCTCTTGGTGGTGAAAtACAATTTCAGACAGAAGTTGAGACAATCAGTTTGGCAGTCCACCGGAATCT
TCTCCGTCTTTCGGGTTTCTGTTCAACTGAAAATGAACGGCTTCTTGTTTATCCATACATGCCCAATGGGAGXTGTAGCATCTAGATTAA
AAGATCATGTCCATGGTAGGCCTGTTCTAGACTGGTCGAGGCGGAAAAAGATTGCTTTAGGTACAGCAAGAGGGCTGGTGTATTTGCATG
AGCAGTGTGACCCCAAAATTATTCATCGAGACGTCAAGGCTGCAAATATTCTGTTGGATGAAGACTTTGAGGCGGTTGTTGGAGATTTTG
GGTTGGCAAAGCTCTTGGATCACCGGGAATCTCATGTAACCACTGCTGTCCGTGGCACTGTTGGTCATATTGCTCCTGAGTATCTGTCTA
CTGGCCAGTCATCAGAAAAGACTGATGTTTTTGGTTTTGGGATCTTACTTCTTGAGTTAATAACAGGCCAGAAGGCGTTGGATTTTGGGC
GGGGAGCCAAGCAGAAAGGCATAATGCTTGACTGGGtAGTCTTTCTTTCTCTTCCAAGCTTGCATTGCACAAACTGCTTTTCTAAATGXT
CTTCAACTCGGGTTAAGTGAGXTGCACACCAATGTGATCACTGTGTGTTTAAGTAAAGATATGATGCGTCTTGCAGATGTACCACTXAAA
CAGATGATACTTGTTCCATCGACACAGGCTTTTGAGTTCTTCGTCCCCATAGATTTTGTTcCCTAGCAAAGGCATTATTAAATTGAAACA
ATGGACAAGTAGATTGTTTGTG(3')CATTATTAAATTGAAACAATGGACAAGTAGATTGTTTGTGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan