ESTScan Details for Unigene SGN-U309312

Score 
502
Direction 
Forward
Predicted Peptide Sequence 
RKMLLHDVSATKMILNSIKYLPIEPEWEEDDVYLVKRKDARKMMSSASRNSKAANEAYQRGDHLSAQLYSRKAREEWLTAERLNAKAAKE
ILSIRNSKNDEWTLDLHGLHAAEAVQALQEHLQRVESQLPTKQLACASRVNATTGIVLSTVPEVAIFRDLDKCGSQ
Predicted Coding Sequence 
XXCAGGAAAATGCTTCTGCATGATGTCTCTGCTACAAAAATGATTCTGAATTCTATCAAATATTTACCCATTGAGCCTGAATGGGAAGAA
GATGATGTTTACTTGGTTAAAAGAAAAGACGCACGAAAGATGATGAGTTCAGCATCCCGGAATTCTAAGGCTGCCAATGAAGCCTATCAG
AGAGGAGATCACTTATCTGCTCAACTCTATTCACGAAAAGCTCGTGAAGAATGGCTGACTGCTGAACGATTAAATGCCAAGGCAGCAAAA
GAAATTCTGAGCATCAGGAATTCGAAGAATGATGAGTGGACATTAGATTTGCATGGTCTTCATGCTGCAGAAGCAGTCCAAGCCTTGCAA
GAACATTTGCAGAGGGTTGAATCTCAGCTGCCTACAAAACAGCTTGCTTGTGCTAGTAGAGTCAATGCAACAACAGGCATTGTACTTTCC
ACAGTTCCTGAGGTTGCAATTTTTAGGGATTTGGATAAGTGTGGTAGCCAG
Edits in Original Sequence 
(5')XXCAGGAAAATGCTTCTGCATGATGTCTCTGCTACAAAAATGATTCTGAATTCTATCAAATATTTACCCATTGAGCCTGAATGGGA
AGAAGATGATGTTTACTTGGTTAAAAGAAAAGACGCACGAAAGATGATGAGTTCAGCATCCCGGAATTCTAAGGCTGCCAATGAAGCCTA
TCAGAGAGGAGATCACTTATCTGCTCAACTCTATTCACGAAAAGCTCGTGAAGAATGGCTGACTGCTGAACGATTAAATGCCAAGGCAGC
AAAAGAAATTCTGAGCATCAGGAATTCGAAGAATGATGAGTGGACATTAGATTTGCATGGTCTTCATGCTGCAGAAGCAGTCCAAGCCTT
GCAAGAACATTTGCAGAGGGTTGAATCTCAGCTGCCTACAAAACAGCTTGCTTGTGCTAGTAGAGTCAATGCAACAACAGGCATTGTACT
TTCCACAGTTCCTGAGGTTGCAATTTTTAGGGATTTGGATAAGTGTGGTAGCCAG(3')G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan