ESTScan Details for Unigene SGN-U309594

Score 
654
Direction 
Forward
Predicted Peptide Sequence 
VTEVAESSQRNFSFGADLGHQEPAPFDLSAAASDVRHSNAHSTNHQSRLISSTESPELRTPFSRPLNLNSNPSQSPFMHVHGLARNMLPI
SWSGSLNSRGGASSSPILFSGERGAAVRDEANFRGSLSNNPEHPSFVAARESRHMVQEPTAWSFSPGNTGSSRNVPSSSRYTPNSGTGPL
PTVWMPHQNVAAHNQQRLSEFPPWTLFPSVEPDPGGQRGNFSFLPSASSSSEEAVMASGSSSGDHNQPYSRSLLMEVSSEDINGWRALAA
GIEGRHRIVSEIRQVLTX
Predicted Coding Sequence 
XXGGTTACTGAGGTTGCAGAAAGCTCACAAAGAAATTTCAGTTTCGGAGCGGATCTTGGACATCAGGAGCCAGCCCCATTTGACTTATCT
GCTGCAGCGTCTGATGTTAGGCATTCTAATGCTCACTCTACGAACCACCAATCAAGACTTATCTCATCAACTGAATCGCCTGAACTGAGA
ACTCCGTTTTCTCGTCCACTGAATTTAAACAGTAACCCAAGTCAGTCTCCTTTCATGCATGTGCATGGTTTGGCAAGAAATATGCTTCCG
ATTTCTTGGAGTGGATCTCTTAACTCAAGAGGTGGTGCTTCATCCAGTCCTATTTTGTTTTCAGGGGAAAGAGGTGCTGCAGTAAGGGAT
GAAGCCAATTTCAGAGGCTCGCTAAGCAACAACCCAGAGCATCCTAGTTTTGTTGCTGCTCGTGAGAGCAGGCACATGGTACAAGAACCA
ACAGCTTGGAGTTTTTCACCTGGAAATACTGGCTCTTCAAGAAATGTTCCTTCTAGTTCTCGATATACTCCTAATTCTGGTACAGGACCT
CTCCCAACTGTCTGGATGCCTCATCAAAATGTAGCAGCACATAATCAGCAGAGGTTGTCCGAATTCCCTCCATGGACCCTCTTCCCATCT
GTTGAACCTGATCCTGGAGGCCAGAGAGGCAATTTTTCATTCTTGCCTTCAGCCTCTTCTTCCTCAGAGGAGGCTGTGATGGCATCTGGA
TCTAGTAGTGGGGACCATAATCAGCCATATTCTAGGTCATTGTTGATGGAGGTTTCCAGCGAGGACATTAATGGTTGGCGTGCTTTAGCT
GCTGGCATTGAGGGGAGGCACAGGATCGTGTCTGAGATTCGTCAAGTGCTGACTGXX
Edits in Original Sequence 
(5')XXGGTTACTGAGGTTGCAGAAAGCTCACAAAGAAATTTCAGTTTCGGAGCGGATCTTGGACATCAGGAGCCAGCCCCATTTGACTT
ATCTGCTGCAGCGTCTGATGTTAGGCATTCTAATGCTCACTCTACGAACCACCAATCAAGACTTATCTCATCAACTGAATCGCCTGAACT
GAGAACTCCGTTTTCTCGTCCACTGAATTTAAACAGTAACCCAAGTCAGTCTCCTTTCATGCATGTGCATGGTTTGGCAAGAAATATGCT
TCCGATTTCTTGGAGTGGATCTCTTAACTCAAGAGGTGGTGCTTCATCCAGTCCTATTTTGTTTTCAGGGGAAAGAGGTGCTGCAGTAAG
GGATGAAGCCAATTTCAGAGGCTCGCTAAGCAACAACCCAGAGCATCCTAGTTTTGTTGCTGCTCGTGAGAGCAGGCACATGGTACAAGA
ACCAACAGCTTGGAGTTTTTCACCTGGAAATACTGGCTCTTCAAGAAATGTTCCTTCTAGTTCTCGATATACTCCTAATTCTGGTACAGG
ACCTCTCCCAACTGTCTGGATGCCTCATCAAAATGTAGCAGCACATAATCAGCAGAGGTTGTCCGAATTCCCTCCATGGACCCTCTTCCC
ATCTGTTGAACCTGATCCTGGAGGCCAGAGAGGCAATTTTTCATTCTTGCCTTCAGCCTCTTCTTCCTCAGAGGAGGCTGTGATGGCATC
TGGATCTAGTAGTGGGGACCATAATCAGCCATATTCTAGGTCATTGTTGATGGAGGTTTCCAGCGAGGACATTAATGGTTGGCGTGCTTT
AGCTGCTGGCATTGAGGGGAGGCACAGGATCGTGTCTGAGATTCGTCAAGTGCTGACTGXX(3')G

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan