ESTScan Details for Unigene SGN-U309724

Score 
355
Direction 
Forward
Predicted Peptide Sequence 
FVLSSVAKPIPAVSEFVAQLQILELLDNAIFTAGYKAVLHIHAIVEECEIVELMQQIDPKTKKPMKKKPLFVKNGAVVVCRIQVNNLMCV
EKFSDFPQLGRFTLRTEGKTVAVGKVTSLPSMVIMLKTILTWAWLRXVKFEHTSGQQNEVFTYYGISVADVEEGPFMARXIVRLVILVWN
LNRFSTLVDAAVYNGWLLLHSAVIGVFM
Predicted Coding Sequence 
XXGTTTGTTTTGAGCAGTGTTGCCAAGCCAATACCTGCTGTATCTGAGTTTGTCGCGCAGCTACAGATTTTGGAATTGCTGGATAATGCT
ATTTTTACTGCTGGTTACAAGGCTGTATTGCATATTCATGCTATTGTTGAGGAATGTGAAATTGTTGAACTAATGCAGCAGATTGACCCG
AAGACAAAAAAGCCAATGAAGAAGAAACCTCTTTTTGTAAAGAATGGTGCTGTTGTCGTTTGTCGTATCCAGGTGAATAATTTGATGTGT
GTTGAGAAATTCTCTGATTTTCCACAGCTTGGACGCTTCACTCTTCGAACTGAAGGGAAAACTGTTGCTGTGGGAAAAGTTACTAGCCTT
CCATCCATGGTGATCATGCTTAAAACAATTTTGACATGGGCTTGGCTTCGAGXTGTAAAATTTGAACATACTAGTGGGCAGCAGAATGAG
GTTTTTACCTATTATGGTATCTCGGTTGCAGATGTGGAAGAAGGTCCATTCATGGCTCGTGAXATCGTGAGACTTGTTATTTTAGTCTGG
AATCTGAATAGATTTTCGACTCTTGTGGATGCTGCCGTCTACAATGGTTGGTTGTTATTGCATTCAGCTGTGATTGGGGTATTTATGTGA
Edits in Original Sequence 
(5')XXGTTTGTTTTGAGCAGTGTTGCCAAGCCAATACCTGCTGTATCTGAGTTTGTCGCGCAGCTACAGATTTTGGAATTGCTGGATAA
TGCTATTTTTACTGCTGGTTACAAGGCTGTATTGCATATTCATGCTATTGTTGAGGAATGTGAAATTGTTGAACTAATGCAGCAGATTGA
CCCGAAGACAAAAAAGCCAATGAAGAAGAAACCTCTTTTTGTAAAGAATGGTGCTGTTGTCGTTTGTCGTATCCAGGTGAATAATTTGAT
GTGTGTTGAGAAATTCTCTGATTTTCCACAGCTTGGACGCTTCACTCTTCGAACTGAAGGGAAAACTGTTGCTGTGGGAAAAGTTACTAG
CCTTCCATCCATaGGTGATCATGCTTAAAACAATTTTGACATGaGGCTTGGCTTCGAGXTGTAAAATTTGAACATACTAGTGcGGCAGCA
GAATGAGGTTTTTACCTATTATGGTATCTCGGTTGCAGATGTGGAAGAAGGTCCATTCgATGGCTCGTGAXATCGTGAGACTTGTTATTT
TAGTCTGGAATCTGAATAGATTTTCGACTCTTGTGGATGCTGCCGTCTACAATGGTTGGTTGTTATTGCATTCAGCTGTGATTGGGGTAT
TTATGTGA(3')AAACATAATAGAGAGTTTTGTATCTGTATTTGAATAAACCTGCATTTCTCATACGATTGTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan