ESTScan Details for Unigene SGN-U309749

Score 
660
Direction 
Forward
Predicted Peptide Sequence 
GNPGLVPSHKPGQIRQLSKLSCAHWWIIHHSLYRQVSGILFTSMATEEEDSDRGGSSDAATAARALRAAQELLNTPDQDDLPHHHAAPAP
PPGPPDRDADDDDEKEEEEEGQEEREDNVNMKFRNYLPHDKQLQEGRVAPPVLPKFEDPVAEAPPCQEKKEDPFLNIAPKKPNWDLWRDV
QKKLDKLEKRTQKAMFQLMGKKKRGGDYLKKVQMEKIDFX
Predicted Coding Sequence 
XXGGGCAATCCAGGGCTTGTGCCTAGTCATAAACCTGGCCAAATTAGACAGTTGAGCAAGCTTTCCTGTGCCCACTGGTGGATAATTCAC
CATTCCTTATACAGACAAGTTTCTGGAATTTTATTCACATCAATGGCGACGGAAGAGGAAGATTCXGATAGAGGGGGCAGCAGCGACGCG
GCGACAGCGGCTAGAGCTCTCAGAGCCGCTCAGGAACTCCTCAACACTCCTGACCAAGACGACCTTCCCCACCACCACGCCGCCCCCGCT
CCTCCTCCTGGTCCTCCAGACCGCGACGCCGACGACGATGACGAAAAAGAAGAAGAAGAAGAAGGCCAAGAAGAACGAGAAGACAATGTC
AACATGAAATTCCGGAATTACCTTCCTCATGATAAGCAGCTTCAGGAGGGGAGAGTTGCTCCTCCGGTACTACCAAAATTTGAAGACCCT
GTGGCTGAAGCACCTCCTTGTCAAGAGAAGAAAGAGGACCCGTTTCTAAATATTGCCCCAAAGAAGCCGAATTGGGATCTGTGGAGGGAT
GTACAGAAGAAGCTTGACAAGCTAGAGAAACGTACACAAAAAGCAATGTTTCAGCTTATGGGGAAGAAGAAAAGAGGAGGAGATTATCTG
AAGAAGGTGCAGATGGAGAAGATTGACTTTTXX
Edits in Original Sequence 
(5')XXGGGCAATCCAGGGCTTGTGCCTAGTCATAAACCTaGGCCAAATTAGACAGTTGAGCAAGCTTTCCTGTGCCCACTGGTGGATAA
TTCACCATTCCTTATACAGACAAGTTTCTGGAATTTTATTCACATCAATGGCGACGGAAGAGGAAGATTCXGATAGAGGGGGCAGCAGCG
ACGCGGCGACAGCGGCtTAGAGCTCTCAGAGCCGCTCAGGAACTCCTCAACACTCCTGACCAAGACGACCTTCCCCACCACCACGCCGCC
CCCGCTCCTCCTCCTGGTCCTCCAGACCGCGACGCCGACGACGATGACGAAAAAGAAGAAGAAGAAGAAGGCCAAGAAGAACGAGAAGAC
AATGTCAACATGAAATTCCGGAATTACCTTCCTCATGATAAGCAGCTTCAGGAGGGGAGAGTTGCTCCTCCGGTACTACCAAAATTTGAA
GACCCTGTGGCTGAAGCACCTCCTTGTCAAGAGAAGAAAGAGGACCCGTTTCTAAATATTGCCCCAAAGAAGCCGAATTGGGATCTGTGG
AGGGATGTACAGAAGAAGCTTGACAAGCTAGAGAAACGTACACAAAAAGCAATGTTTCAGCTTATGGcGGAAGAAGAAAAGAGGAGGAGA
TTATCTGAAGAAGGTGCAGATGGAGAAGATTGACTTTTXX(3')TCATTTCTTGTTGGGNACGCGCTGTAATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan