ESTScan Details for Unigene SGN-U309768

Score 
193
Direction 
Forward
Predicted Peptide Sequence 
VAENGFEFQVYLVEALYGLNILDRLRALVNVLKILTEQNPSINKKRRNDDLCARQFFKXYHGTIQYHHVLHHLNVALFSFIAEYELVANA
SHCFRDR
Predicted Coding Sequence 
XCTGTAGCGGAGAATGGTTTTGAGTTTCAAGTTTACCTGGTGGAAGCTCTTTATGGCTTGAACATCTTGGACCGTTTGAGAGCATTGGTG
AATGTTTTGAAGATCCTTACAGAGCAGAACCCCTCCATAAACAAGAAGAGGAGAAATGATGATCTCTGTGCTCGGCAATTTTTCAAAGXT
TATCATGGTACCATCCAATATCACCATGTTTTGCACCATCTAAATGTTGCTTTATTTTCCTTTATTGCTGAGTATGAGTTGGTGGCTAAT
GCTTCTCATTGTTTTAGGGACCGTTAG
Edits in Original Sequence 
(5')XCTGTAGCGGAGAATGGTTTTGAGTTTCAAGTTTACCTGGTGGAAGCTCTTTATGGCTTGAACATCTTGGACCGTTTGAGAGCATT
GGTGAATGTTTTGAAGATCCTTACAGAGCAGAACCCCTCCATAAACAAGAAGAGGAGAAATGaATGATCTCTGTGCTCGGCAATTTTTCA
AAGXTTATCATGGTACCATCCAATATCACCATGTTTTGCACCATCTAAATGTTGCTTTATTTTCCTTTATTGCTGAGTATGAGTTGGTGG
CTaAATGCTTCTCATTGTTTTAGGGACCGTTAG(3')GAGTACCTTTACAAGCCTTTTTTTGTTTTTTTTTTTTGAAGGAACTGCTATTG
AACCTTGCAACAATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan