ESTScan Details for Unigene SGN-U309821

Score 
294
Direction 
Forward
Predicted Peptide Sequence 
INEALDTVFSMPMKPDSVIWRSLLDACCKKDAGLELSEEMARHMIECEGSDCSGAYVLLSRLYALANRWNEVGLVRKLMAEKGVNKEPGC
SIVEIDGIAHEFFAGDTSHPQTTEIYQHLDVIEEKLTSMGYSPDISQAAMVDEDGDGKGRSX
Predicted Coding Sequence 
XXCATTAACGAAGCACTTGATACTGTATTCAGCATGCCAATGAAACCCGATTCGGTGATTTGGAGGAGTCTTCTTGATGCTTGTTGCAAG
AAAGATGCAGGACTAGAGCTTAGTGAAGAAATGGCCAGGCATATGATTGAATGTGAAGGCAGCGATTGCAGTGGTGCGTATGTCTTATTG
TCAAGGTTGTATGCCTTGGCTAATCGCTGGAACGAGGTTGGCTTGGTCAGGAAACTGATGGCAGAAAAGGGTGTTAACAAAGAGCCTGGC
TGTAGTATAGTGGAAATTGATGGCATTGCTCACGAATTTTTCGCTGGGGATACATCTCATCCTCAAACTACGGAGATTTACCAGCATTTA
GATGTGATTGAAGAAAAGTTGACTTCTATGGGTTATAGTCCTGATATTTCACAGGCAGCTATGGTAGATGAAGATGGTGATGGAAAAGGG
CGGTCTCXX
Edits in Original Sequence 
(5')XXCATTAACGAAGCACTTGATACTGTATTCAGCATGCCAATGAAACCCGATTCGGTGATTTGGAGGAGTCTTCTTGATGCTTGTTG
CAAGAAAGATGCAGGACTAGAGCTTAGTGAAGAAATGGCCAGGCATATGATTGAATGTGAAGGCAGCGATTGCAGTGGTGCGTATGTCTT
ATTGTCAAGGTTGTATGCCTTGGCTAATCGCTGGAACGAGGTTGGCTTGGTCAGGAAACTGATGGCAGAAAAGGGTGTTAACAAAGAGCC
TGGCTGTAGTATAGTGGAAATTGATGGCATTGCTCACGAATTTTTCGCTGGGGATACATCTCATCCTCAAACTACGGAGATTTACCAGCA
TTTAGATGTGATTGAAGAAAAGTTGACTTCTATGGGTTATAGTCCTGATATTTCACAGGCAGCTATGGTAGATGAAGATGGTGATGGAAA
AGGGCGGTCTCXX(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan