ESTScan Details for Unigene SGN-U309834

Score 
417
Direction 
Forward
Predicted Peptide Sequence 
HAAFILISAPPTLPPKLLNPTKESQTGAAESTKRXALNKGKAEIFNSQPLXKSTSRISIMATPQILQREEDLLLWQSLFDDPKGENEKCR
GTDIEKKIEFLESLTGKVSNRRSRRWLNDRLLMELVPRLNAEEIRGLFAPPPWGDDVPLSPFSMTNIGEWDKFRTVDMDKETMMIEALKG
SGMKQKSHGDADEVAVLTAWHRVDCRTREAFRRSFLPXLISGYEECIRDFV
Predicted Coding Sequence 
XXGCACGCGGCTTTTATTCTGATTTCTGCTCCTCCCACCCTGCCTCCTAAACTACTCAATCCCACAAAAGAAAGTCAGACAGGAGCAGCT
GAATCAACGAAACGCXCCGCCCTCAACAAAGGAAAAGCAGAGATTTTTAATTCTCAGCCCCTCGAXAAGTCAACTTCAAGAATATCAATT
ATGGCGACCCCTCAGATTTTGCAGAGAGAAGAAGATCTTCTCTTATGGCAGTCCCTCTTTGATGACCCCAAAGGAGAAAATGAGAAGTGC
AGAGGAACGGATATTGAGAAAAAGATCGAGTTCCTGGAGAGCTTGACTGGAAAAGTCAGCAACCGGAGATCTCGAAGATGGTTAAATGAT
CGCCTTTTAATGGAGCTCGTTCCTCGTCTAAATGCAGAAGAAATTAGAGGCTTGTTTGCTCCACCGCCTTGGGGTGATGATGTGCCACTG
TCCCCATTTAGCATGACAAATATAGGAGAATGGGACAAATTTAGAACCGTGGATATGGATAAAGAGACGATGATGATAGAAGCCCTCAAA
GGTTCAGGAATGAAACAGAAAAGTCATGGTGATGCAGACGAGGTTGCTGTACTTACTGCATGGCATAGAGTTGATTGTAGAACTAGAGAA
GCTTTCCGTCGTAGCTTTCTTCCAGAXTTGATAAGTGGATATGAGGAGTGCATCCGGGACTTTGTX
Edits in Original Sequence 
(5')XXGCACGCGGCTTTTATTCTGATTTCTGCTCCTCtCCACCCTGCCTCCTAAACTACTCAATCCCACAtAAAGAAAGTCAGACAGGA
GCAGCTGAATCAACGAAACGCXCCGCCCTCAACAAAGGAAAAGCAGAGATTTTTAATTCTCAGCCCCTCGAXAAGTCAACTTCAAGAATA
TCAATTATGGCGACCCCTCAGATTTTGCAGAGAGAAGAAGATCTTCTCTTATGGCAGTCCCTCTTTGATGACCCCAAAGGAGAAAATGAG
AAGTGCAGAGGAACGGATATTGAGAAAAAGATCGAGTTCCTGGAGAGCTTGACTGGAAAAGTCAGCAACCGGAGATCTCGAAGATGGTTA
AATGATCGCCTTTTAATGGAGCTCGTTCCTCGTCTAAATGCAGAAGAAATTAGAGGCTTGTTTGCTCCACCGCCTTGGGGTGATGATGTG
CCACTGTCCCCATTTAGCATGACAAATATAGGAGAATGGGACAAATTTAGAACCGTGGATATGGATAAAGAGACGATGATGATAGAAGCC
CTCAAAGGTTCAGGAATGAAACAGAAAAGTCATGGTGATGCAGACGAGGTTGCTGTACTTACTGCATGGCATAGAGTTGATTGTAGAACT
AGAGAAGCTTTCCGTCGTAGCTTTCTTCCAGAXTTGATAAGTGGATATGAGGAGTGCATCCGGGACTTTGTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan