ESTScan Details for Unigene SGN-U309866

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
KQKGLSSKYLPQLNVSGRVIHPGHVGDQAQAGTVTTLGXGTPILVTSPVGRTVADMVRVGEFRAEEAIRCCHDCLSALHTAASAGMRHGD
IRPENVICVTSGRGQPYFVLIGWGHAILEERDRPAMNLHFSSTYALQEGKLCSASDAESLVYMLYFASGADLPDLDSXGGGTAMERNLLV
KEADQQKLGDMSAVLKAFADYVDSLCGTPYP
Predicted Coding Sequence 
XXGAAACAAAAGGGGTTGTCTAGCAAGTATCTGCCACAATTGAATGTATCTGGCAGAGTAATTCACCCTGGTCATGTCGGAGACCAAGCT
CAGGCGGGAACTGTGACCACCCTTGGTGXTGGTACTCCAATATTAGTAACTAGCCCTGTTGGGAGGACTGTGGCTGATATGGTGAGAGTT
GGTGAATTCCGTGCAGAGGAGGCTATCAGGTGCTGCCATGATTGTTTATCTGCCCTTCATACTGCTGCATCAGCTGGAATGCGGCACGGA
GATATTCGACCTGAGAATGTTATTTGTGTGACATCTGGAAGGGGGCAGCCTTATTTTGTCCTTATTGGTTGGGGACATGCTATCTTAGAG
GAGAGAGATCGTCCAGCAATGAATCTTCATTTCTCCTCTACATATGCCCTTCAAGAGGGAAAGTTGTGCTCGGCTTCTGATGCCGAGAGC
CTTGTGTATATGCTTTACTTTGCCTCGGGTGCAGACTTGCCTGATCTTGATTCTGXTGGAGGGGGCACTGCAATGGAGAGAAACCTCTTG
GTCAAAGAGGCTGATCAACAGAAGCTTGGAGATATGTCTGCTGTCTTGAAAGCATTTGCAGATTATGTTGATAGTTTATGCGGAACACCA
TATCCX
Edits in Original Sequence 
(5')XXGAAACAAAAGGGGTTGTCTAGCAAGTATCTGCCACAATTGAATGTATCTGGCAGAGTAATTCACCCTGGTCAgTGTCGGAGACC
AAGCTCAGGCGGGAACTGTGACCACCCTTGGTGXTGGTACTCCAATATTAGTAACTAGCCCTGTTGGGAGGACTGTGGCTGATATGGTGA
GAGTTGGTGAATTCCGTGCAGAGGAGGCTATCAGGTGCTGCCATGATTGTTTATCTGCCCTTCATACTGCTGCATCAGCTGGAATGCGGC
ACGGAGATATTCGACCTGAGAATGTTATTTGTGTGACATCTGGAAGGGGGCAGCCTTATTTTGTCCTTATTGGTTGGGGACATGCTATCT
TAGAGGAGAGAGATCGTCCAGCAATGAATCTTCATTTCTCCTCTACATATGCCCTTCAAGAGGGAAAGTTGTGCTCGGCTTCTGATGCCG
AGAGCCTTGTGTATATGCTTTACTTTGCCTCGGGTGCAGACTTGCCTGATCTTGATTCTGXTGGAGGGGGCACTGCAATGGAGAGAAACC
TCTTGGTCAAAGAGGCTGATaCAACAGAAGCTTGGAGATATGTCTGCTGTCTTGAAAGCATTTGCAGATTATGTTGATAGTTTATGCGGA
ACACCATATCCX(3')CTATGGATTATGACAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan