ESTScan Details for Unigene SGN-U309897

Score 
208
Direction 
Reverse
Predicted Peptide Sequence 
PAEGASRLSKIMQVTHHHPSLDESTLLHLSKELHDNMYSQVGANSEQNFLSEKTLMSDKSPPEFPEKSLCSSLCNSVALFLDDLLSPPAI
KTPFHDFLQAPMCIIDSSTININSKDTAARKLLCNGYRDDATITANIQTILAFKPFFLHDLXILDPRPNPDLSENHHHQSI
Predicted Coding Sequence 
XXCCCGGCTGAAGGAGCATCCAGACTTTCGAAAATAATGCAAGTAACCCATCATCACCCCAGTTTAGATGAATCCACTTTGTTACACTTA
AGCAAAGAATTGCATGATAATATGTATTCTCAGGTGGGTGCCAACTCTGAACAAAATTTCCTTTCTGAAAAGACACTXATGTCAGACAAA
TCTCCTCCAGAATTCCCAGAAAAGTCCCTTTGTAGTTCACTTTGCAACTCAGTTGCACTTTTCTTGGATGATTTACTTTCTCCCCCTGCT
ATTAAAACTCCTTTTCATGATTTTCTTCAGGCTCCAATGTGCATCATCGATTCGAGCACGATCAATATCAACTCCAAGGATACTGCGGCA
AGAAAACTTCTTTGCAATGGTTATCGTGATGATGCCACTATTACAGCCAATATCCAGACAATCCTTGCCTTCAAACCATTCTTTCTTCAT
GACCTTXTAATCTTGGATCCTCGTCCAAATCCTGACTTATCTGAGAACCACCATCATCAATCAATC
Edits in Original Sequence 
(5')XXCCCGGCTGAAGGAGCATCCAGACTTTCGAAAATAATGCAAGTAACCCATCATCACCCCAGTTTAGATGAATCCACTTTGTTACA
CTTAAGCAAAGAATTGCATGATAATATGTATTCTCAGGTGGGTGCCAACTCTGAACAAAATTTCCTTTCTGAAAAGACACTXATGTCAGA
CAAATCTCCTCCAGAATTCCCAGAAAAGTCCCTTTGTAGTTCACTTTGCAACTCAGTTGCACTTTTCTTGGAtTGATTTACTTTCTCCCC
CTGCaTATTAAAACTCCTTTTCATGATTTTCTTCAGGCTCCAATGTGCATCATCGATTCGAGCACGATCAATATCAACTCCAAGGATACT
GCGGCAAGAAAACTTCTTTGCAATGGTTATCGTGATGATGCCACTATTACAGCCAATATCCAGACAATCCTTGCCTTCAAACCATTCTTT
CTTCATGACCTTXTAATCTTGGATCCTCGTCCAAATCCTGACTTATCTGAGAACCACCATCATCAATCAATC(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan