ESTScan Details for Unigene SGN-U310091

Score 
1216
Direction 
Forward
Predicted Peptide Sequence 
MVGPDASDALAVRDTVQQFLNAARTGNLDLFKKLAKQLDDGKGIAQTVADVKDANKRGALHFAAREGKTDMCKYLVEELKLDVNAKDDDG
ETPLLHAARQGHTATAEYLTECGADPSIPSQLGAMALHHSAGIGDTELLKFLISRGVDVDLQSDAGTPLIWAAGHGQQDAVRILLEHRAK
PNIGTEDDVTPLLSAVAADSLQCLELLIQAGAHVNVTAGGATPLHIAADHGSPEMLECLLKAGAIPDSLDEEGVKPIEVAAA
Predicted Coding Sequence 
ATGGTTGGTCCTGATGCTTCTGATGCTCTCGCAGTGAGGGACACAGTTCAGCAGTTCTTGAATGCTGCACGTACTGGGAATTTAGACCTT
TTCAAGAAATTGGCTAAACAACTTGATGATGGGAAGGGAATAGCTCAGACAGTGGCAGATGTTAAGGATGCGAACAAGAGAGGGGCTTTG
CATTTTGCTGCCAGAGAGGGCAAGACTGATATGTGCAAGTACTTGGTTGAGGAGTTGAAGCTTGATGTCAATGCAAAAGATGATGATGGT
GAGACTCCTCTTCTTCATGCTGCAAGGCAAGGACACACAGCTACTGCTGAATACCTTACTGAGTGTGGTGCTGATCCTAGTATACCCAGT
CAATTGGGTGCAATGGCTCTGCATCATTCTGCAGGAATAGGAGATACCGAGTTATTGAAATTCTTAATTTCACGAGGTGTGGATGTTGAT
TTACAAAGTGATGCTGGTACTCCCCTTATATGGGCTGCTGGTCATGGTCAGCAAGATGCTGTCAGAATACTGCTAGAACACCGTGCTAAA
CCAAACATTGGAACTGAAGATGATGTCACTCCTTTGCTGTCTGCGGTGGCAGCAGATTCATTACAATGTCTAGAGTTGTTAATTCAGGCA
GGTGCTCATGTTAATGTTACTGCTGGTGGAGCGACTCCTTTGCACATTGCTGCTGACCATGGTAGCCCTGAAATGTTAGAATGTTTACTA
AAAGCCGGAGCTATTCCTGATTCCCTTGATGAGGAGGGTGTGAAACCTATAGAAGTTGCTGCTGCA
Edits in Original Sequence 
GCTAAAACCTCAATTTGCAGTCAGTCCGTTAAAAGGGTTTTAGAGTCTTCTTCTTCTTCTTCTTCTCTCACAC(5')ATGGTTGGTCCTG
ATGCTTCTGATGCTCTCGCAGTGAGGGACACAGTTCAGCAGTTCTTGAATGCTGCACGTACTGGGAATTTAGACCTTTTCAAGAAATTGG
CTAAACAACTTGATGATGGGAAGGGAATAGCTCAGACAGTGGCAGATGTTAAGGATGCGAACAAGAGAGGGGCTTTGCATTTTGCTGCCA
GAGAGGGCAAGACTGATATGTGCAAGTACTTGGTTGAGGAGTTGAAGCTTGATGTCAATGCAAAAGATGATGATGGTGAGACTCCTCTTC
TTCATGCTGCAAGGCAAGGACACACAGCTACTGCTGAATACCTTACTGAGTGTGGTGCTGATCCTAGTATACCCAGTCAATTGGGTGCAA
TGGCTCTGCATCATTCTGCAGGAATAGGAGATACCGAGTTATTGAAATTCTTAATTTCACGAGGTGTGGATGTTGATTTACAAAGTGATG
CTGGTACTCCCCTTATATGGGCTGCTGGTCATGGTCAGCAAGATGCTGTCAGAATACTGCTAGAACACCGTGCTAAACCAAACATTGGAA
CTGAAGATGATGTCACTCCTTTGCTGTCTGCGGTGGCAGCAGATTCATTACAATGTCTAGAGTTGTTAATTCAGGCAGGTGCTCATGTTA
ATGTTACTGCTGGTGGAGCGACTCCTTTGCACATTGCTGCTGACCATGGTAGCCCTGAAATGTTAGAATGTTTACTAAAAGCCGGAGCTA
TTCCTGATTCCCTTGATGAGGAGGGTGTGAAACCTATAGAAGTTGCTGCTGCA(3')A

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan