ESTScan Details for Unigene SGN-U310164

Score 
263
Direction 
Forward
Predicted Peptide Sequence 
LTVQLPKLQQNSVRDAPDSQGKIEKLEASVEKVIYGCRFFTILAVWGSLVGSFLCFIKGCSYVVASFQEYFVNRGKVMFSLVEALDVYLL
GTVMLVFGMGLYELFISNLDKAKSFADERVPHRSNFFGLFTLKERPQWLEIKSVNQLKTKLGHVIV
Predicted Coding Sequence 
CTCACAGTTCAGCTCCCGAAGTTGCAGCAGAATTCAGTTCGTGATGCTCCTGACTCACAAGGAAAGATTGAAAAGCTAGAAGCAAGTGTA
GAAAAGGTTATATATGGTTGTCGTTTCTTTACTATCCTTGCAGTATGGGGATCTTTGGTGGGATCTTTTCTTTGTTTTATCAAGGGTTGC
AGTTATGTTGTGGCCTCATTCCAAGAATACTTTGTCAACCGAGGGAAGGTGATGTTTTCGCTGGTTGAAGCCCTTGATGTATATCTACTA
GGGACGGTGATGTTGGTTTTTGGAATGGGTCTCTATGAACTCTTCATCAGCAACCTTGACAAAGCAAAATCATTTGCAGATGAAAGAGTT
CCACACAGATCAAATTTTTTTGGCTTATTTACTCTGAAGGAACGTCCACAATGGTTGGAAATTAAATCTGTCAATCAGCTGAAAACCAAA
CTTGGCCATGTGATTGTX
Edits in Original Sequence 
(5')CTCACAGTTCAGCTCCCGAAGTTGCAGCAGAATTCAGTTCGTGATGCtTCCTGACTCACAAGGAAAGATTGAAAAGCTAGAAGCAA
GTGTAGAAAAGGTTATATATGGTTGTCGTTTCTTTACTATCCTTGCAGTATGGGGATCTTTGGTGGGATCTTTTCTTTGTTTTATCAAGG
GTTGCAGTTATGTTGTGGCCTCATTCCAAGAATACTTTGTCAACCGAGGGAAGGTGATGTTTTCGCTGGTTGAAGCCCTTGATGTATATC
TACTAGGGACGGTGATGTTGGTTTTTGGAATGGGTCTCTATGAACTCTTCATCAGCAACCTTGACAAAGCAAAATCATTTGCAGATGAAA
GAGTTCCACACAGATCAAATTTTTTTGGCTTATTTACTCTGAAGGAACGTCCACAATGGTTGGAAATTAAATCTGTCAATCAGCTGAAAA
CCAAACTTGGCCATGTGATTGTX(3')T

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan