Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U310239

Score 
378
Direction 
Forward
Predicted Peptide Sequence 
MANRVDHEYDYLFKIVLIGDSGVGKSNILSRFTRNEFCLESKSTIGVEFATRTLQIEGKTVKAQIWDTAGQERYRAITSAYYRGAVGALL
VYDITKRQTFDNVQRWLRELRDHADSNIVIMMAGNKSDLNHLRAVQENDGQTLAEKEGLSFLETSALEAYNVDKAFQTILSEIYHIISKK
ALAAQEAAASX
Predicted Coding Sequence 
ATGGCCAATAGAGTGGATCACGAGTACGATTATTTATTCAAGATCGTTTTGATCGGGGACTCCGGAGTCGGAAAATCTAACATTCTATCT
AGGTTTACTCGAAATGAGTTCTGTTTGGAGTCTAAATCTACCATCGGAGTTGAGTTTGCAACCCGTACTCTTCAGATAGAGGGAAAGACA
GTCAAGGCGCAAATATGGGACACTGCAGGACAGGAAAGGTATAGGGCTATTACTAGTGCATACTACAGAGGAGCTGTGGGTGCACTCCTT
GTGTACGACATAACCAAGAGGCAAACTTTTGATAATGTCCAAAGGTGGCTTCGGGAATTGAGGGATCATGCTGATTCTAACATTGTCATC
ATGATGGCTGGAAACAAGTCCGACCTTAACCATCTCAGAGCTGTTCAAGAGAACGATGGCCAAACTTTGGCTGAGAAGGAAGGACTCTCT
TTTCTTGAGACGTCAGCGCTGGAAGCATATAACGTGGACAAGGCTTTCCAGACTATTCTGTCAGAAATATATCACATTATAAGCAAGAAA
GCATTGGCTGCCCAGGAAGCGGCTGCCTCCAXX
Edits in Original Sequence 
GGTGAGATAGAGAGGGAGA(5')ATGGCCAATAGAGTGGATCACGAGTACGATTATTTATTCAAGATCGTTTTGATCGGGGACTCCGGAG
TCGGAAAATCTAACATTCTATCTAGGTTTACTCGAAATGAGTTCTGTTTGGAGTCTAAATCTACCATCGGAGTTGAGTTTGCAACCCGTA
CTCTTCAGATAGAGGGAAAGACAGTCAAGGCGCAAATATGGGACACTGCAGGACAGGAAAGGTATAGGGCTATTACTAGTGCATACTACA
GAGGAGCTGTGGGTGCACTCCTTGTGTACGACATAACCAAGAGGCAAACTTTTGATAATGTCCAAAGGTGGCTTCGGGAATTGAGGGATC
ATGCTGATTCTAACATTGTCATCATGATGGCTGGAAACAAGTCCGACCTTAACCATCTCAGAGCTGTTCAAGAGAACGATGGCCAAACTT
TGGCTGAGAAGGAAGGACTCTCTTTTCTTGAGACGTCAGCGCTGGAAGCATATAACGTGGACAAGGCTTTCCAGACTATTCTGTCAGAAA
TATATCACATTATAAGCAAGAAAGCATTGGCTGCCCAGGAAGCGGCTGCCTCCAXX(3')ACCGTGACTCCTGGTCAGGGTACCACCATG
CATGTTAATGATTCGTCTGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan