ESTScan Details for Unigene SGN-U310282

Score 
650
Direction 
Forward
Predicted Peptide Sequence 
KKQMEDFEKKVSISDEPDKMDTEDTVVLSATKIVGLLRKFLAVQQRRAQAYAKLKSGFEDYMVSGSESAYQQLCSEITVEFNDCSREVLD
LESLFRSADFFREDLACLLKSVQTQEKQKLQLTATIQVLKKVGRPSERLVSHENCRFNRAIGHQCVHINKITEASGTEEAEADAEYDNAL
KEAIRGVQNAVITINEHLEEVRYEIAALETE
Predicted Coding Sequence 
AAAAAACAGATGGAAGATTTTGAGAAGAAGGTTTCAATCTCGGATGAACCAGACAAGATGGATACCGAGGATACTGTTGTTCTTAGCGCT
ACAAAAATCGTGGGTTTACTTCGTAAATTCCTCGCCGTCCAACAACGCAGAGCTCAAGCTTATGCAAAACTCAAAAGTGGATTTGAGGAC
TATATGGTGTCAGGAAGTGAGTCAGCTTACCAACAACTTTGCAGTGAGATCACTGTTGAATTCAATGACTGTTCAAGAGAAGTCCTTGAT
TTGGAATCACTCTTTCGCAGCGCTGATTTCTTTCGGGAGGATCTTGCTTGTCTACTCAAATCAGTTCAAACACAAGAAAAGCAGAAGCTG
CAACTGACTGCTACCATTCAGGTGTTGAAGAAGGTTGGCCGTCCTTCAGAACGTCTTGTGAGCCACGAGAATTGCAGATTTAATAGGGCA
ATTGGACACCAGTGTGTGCATATCAATAAGATAACTGAAGCCTCTGGAACTGAAGAGGCAGAGGCTGATGCAGAGTATGATAATGCTCTA
AAGGAAGCCATCAGAGGTGTGCAGAATGCTGTAATTACCATAAATGAACATTTGGAAGAAGTTAGATATGAGATTGCAGCCCTGGAAACC
GAGTAA
Edits in Original Sequence 
(5')AAAAAACAGATGGAAGATTTTGAGAAGAAGGTTTCAATCTCGGATGAACCAGACAAGATGGATACCGAGGATACTGTTGTTCTTAG
CGCTACAAAAATCGTGGGTTTACTTCGTAAATTCCTCGCCGTCCAACAACGCAGAGCTCAAGCTTATGCAAAACTCAAAAGTGGATTTGA
GGACTATATGGTGTCAGGAAGTGAGTCAGCTTACCAACAACTTTGCAGTGAGATCACTGTTGAATTCAATGACTGTTCAAGAGAAGTCCT
TGATTTGGAATCACTCTTTCGCAGCGCTGATTTCTTTCGGGAGGATCTTGCTTGTCTACTCAAATCAGTTCAAACACAAGAAAAGCAGAA
GCTGCAACTGACTGCTACCATTCAGGTGTTGAAGAAGGTTGGCCGTCCTTCAGAACGTCTTGTGAGCCACGAGAATTGCAGATTTAATAG
GGCAATTGGACACCAGTGTGTGCATATCAATAAGATAACTGAAGCCTCTGGAACTGAAGAGGCAGAGGCTGATGCAGAGTATGATAATGC
TCTAAAGGAAGCCATCAGAGGTGTGCAGAATGCTGTAATTACCATAAATGAACATTTGGAAGAAGTTAGATATGAGATTGCAGCCCTGGA
AACCGAGTAA(3')ACTAGTTCACAGCATACTTGTAGAACAGTAACTAGTACTTATCTGGTAATAGCATGATATTTCCTGTCNTAGTTGC
ATCATTAAAAAGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan