ESTScan Details for Unigene SGN-U310457

Score 
398
Direction 
Forward
Predicted Peptide Sequence 
NFPLKLLITKTTNMYVARKAQRPCPSVNIFIIVLSFFSFTLSPFSPQVVSASAFKRLQLFSTEEAQPSSTSSVLSLSLHPRSSIKKLPYN
NYSDLVLSRLASDRAQAKLINSNIEGAVSTFNCLHAVKPDVQVQPEDLKTPLTHSEGGYLARIGVGQPEKEFHLIADTGAKSPGSNACPA
IHATNNPDPIFDPSGSSSFSPLSCASQECTSLKKNQNCKADPCTYNASYGDNFSSMGEFATETVSFGSWALLTX
Predicted Coding Sequence 
XXCAACTTCCCCTTAAAACTTCTCATCACCAAAACCACAAACATGTACGTGGCTCGAAAAGCTCAAAGGCCATGTCCTTCCGTTAACATC
TTCATCATCGTCCTCTCCTTCTTCTCTTTCACCCTCAGTCCTTTTTCACCTCAGGTTGTCTCTGCTTCAGCTTTCAAGAGGCTTCAACTC
TTCTCAACAGAAGAAGCTCAGCCTAGCTCAACCTCCTCCGTCTTGTCACTCTCCCTACATCCTCGTTCCTCCATCAAGAAGCTGCCATAC
AACAACTACTCTGACCTGGTACTCTCCCGACTCGCGAGTGACCGAGCCCAAGCCAAGCTCATCAACTCCAACATCGAAGGGGCTGTCTCC
ACCTTCAACTGCCTTCATGCTGTTAAACCGGACGTACAAGTCCAGCCGGAGGACCTCAAAACTCCACTGACTCATTCTGAGGGAGGGTAC
TTAGCTCGGATCGGAGTGGGCCAACCCGAGAAAGAATTCCACCTGATAGCGGATACGGGTGCCAAATCACCTGGCTCCAATGCCTGCCCT
GCGATCCATGCTACAAACAATCCXGACCCGATCTTTGACCCATCCGGGTCTTCATCTTTTAGTCCTTTATCCTGTGCATCGCAGGAGTGT
ACCTCCCTGAAAAAAAACCAAAATTGCAAAGCTGACCCGTGTACGTATAACGCGTCGTACGGAGATAACTTCAGTAGCATGGGCGAATTC
GCCACCGAAACGGTGTCGTTTGGAAGTTGGGCTCTGTTGACAAAX
Edits in Original Sequence 
(5')XXCAACTTCCCCTTAAAACTTCTCATCACCAAAACCACAAACATGTACGTGGCTCGAAAAGCTCAAAGGCCATGTCCTTCCGTTAA
CATCTTCATCATCGTCCTCTCCTTCTTCTCTTTCACCCTCAGTCCTTTTTCACCTCAGGTTGTCTCTGCTTCAGCTTTCAAGAGGCTTCA
ACTCTTCTCAACAGAAGAAGCTCAGCCTAGCTCAACCTCCTCCGTCTTGTCACTCTCCCTACATCCTCGTTCCTCCATCAAGAAGCTGCC
ATACAACAACTACTCTGACCTGGTACTCTCCCGACTCGCGAGTGACCGAGCCCAAGCCAAGCTCATCAACTCCAACATCGAAGGGGCTGT
CTCCACCTTCAACTGCCTTCATGCTGTTAAACCGGACGTACAAGTCCAGCCGGAGGACCTCAAAACTCCACTGACTCATTCTGAGGGAGG
GTACTTAGCTCGGATCGGAGTGGGCCAACCCGAGAAAGAATTCCACCTGATAGCGGATACGGGTaGCCAAATCACCTGGCTCCAATGCCT
GCCCTGCGATCCATGCTACAAACAATCCXGACCCGATCTTTGACCCATCCGGGTCTTCATCTTTTAGTCCTTTATCCTGTGCATCGCAGG
AGTGTACCTCCCTGAAAAAAAACCAAAATTGCAAAGCTGACCCGTGTACGTATAACGCGTCGTACGGAGATAACTTCAGTAGCATGGGCG
AATTCGCCACCGAAACGGTGTCGTTTGGAAGTTcGGGCTCTGTTGACAAAX(3')AATAGCCATCGGGTGCGGGCATACAAACCAGGGCG
GGTTTGGCGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan