ESTScan Details for Unigene SGN-U310467

Score 
328
Direction 
Forward
Predicted Peptide Sequence 
ADEADKEAAGTSEEVEIDALAIDESKKVKNDLTDPDDSSIEAVTSGDTPYASAKKFEDLNLSSELLKGLYVEMKFERPSKIQAISLPMIL
TPPFKNLIAQAHNGSGKTTCFVLGMLSRMDPKLSAPQALCICPTRELAIQNMEVLLKMGKFTGITSELAIPADSASFIPILKRPPVTAHV
VIGTPGTISXVDNSKETEHEFHX
Predicted Coding Sequence 
XXGGCCGACGAAGCTGACAAAGAAGCTGCAGGAACCTCCGAGGAAGTTGAAATCGATGCATTAGCGATCGATGAGTCCAAGAAAGTTAAA
AACGACCTTACAGATCCGGACGACTCGTCCATCGAAGCTGTCACATCGGGGGACACTCCTTACGCATCAGCAAAGAAGTTTGAGGACTTG
AATTTGTCTTCCGAACTGTTGAAGGGTTTATACGTAGAAATGAAATTTGAGAGACCTAGCAAGATCCAAGCAATCAGCTTGCCGATGATT
CTGACTCCACCATTCAAGAATTTGATTGCTCAAGCCCACAATGGTTCGGGAAAGACCACTTGCTTTGTTCTTGGTATGTTGAGCCGTATG
GACCCAAAGCTCTCGGCTCCTCAGGCTCTCTGCATCTGCCCCACTCGCGAACTAGCAATTCAGAATATGGAAGTATTGTTGAAGATGGGG
AAATTCACAGGGATAACATCAGAATTAGCTATCCCAGCAGATAGTGCCAGCTTCATACCAATCTTAAAGAGACCTCCTGTTACAGCACAT
GTGGTGATTGGAACACCTGGTACAATAAGTAAXGTGGATAACAGCAAGGAAACTGAGCATGAGTTTCATGAX
Edits in Original Sequence 
(5')XXGGCCGACGAAGCTGACAAAGAAGCTGCAGGAACCTCCGAGGAAGTTGAAATCGATGCATTAGCGATCGATGAGTCCAAGAAAGT
TAAAAACGACCTTACAGATCCGGACGACTCGTCCATCGAAGCTGTCACATCGGGGGACACTCCTTACGCATCAGCAAAGAAGTTTGAGGA
CTTGAATTTGTCTTCCGAACTGTTGAAGGGTTTATACGTAGAAATGAAATTTGAGAGACCTAGCAAGATCCAAGCAATCAGCTTGCCGAT
GATTCTGACTCCACCATTCAAGAATTTGATTGCTCAAGCCCACAATGGTTCGGGAAAGACCACTTGCTTTGTTCTTGGTATGTTGAGCCG
TATGGACCCAAAGCTCTCGGCTCCTCAGGCTCTCTGCATCTGCCCCACTCGCGAACTAGCAATTCAGAATATGGAAGTATTGTTGAAGAT
GGGGAAATTCACAGGGATAACATCAGAATTAGCTATCCCAGCAGATAGTGCCAGCTTCATACCAATCTTAAAGAGACCTCCTGTTACAGC
ACATGTGGTGATTGGAACACCTGGTACAATAAGTAAXGTGGATAACAGCAAGGAAACTGAGCATGAGTTTCATGAX(3')AGATTCCTTG
TGTTTGATGAGGCAGACCACATGTTAGCTGACAGCGGGTTTAAGGATGACTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan