ESTScan Details for Unigene SGN-U310469

Score 
614
Direction 
Forward
Predicted Peptide Sequence 
YEKLGASFKKAKAVLIGKVDCDEHKSLCSKYGVSGYPTIQWFPKGSLEPKKYEGARSAEALAEFVNSEGGTNVKIAAVPSNVVVLTPENF
DEIVLDEKKDVLVEFYAPWCGHCKSLAPTYEKVATAFKLEDHVVIANVDADKYKDLAEKY
Predicted Coding Sequence 
XXGTACGAAAAGCTCGGTGCGAGTTTCAAGAAAGCTAAAGCTGTTTTGATTGGAAAGGTGGACTGCGATGAGCATAAGAGCCTTTGCAGC
AAATATGGTGTTTCTGGCTACCCCACCATCCAATGGTTTCCGAAAGGTTCCTTGGAGCCCAAAAAGTATGAAGGTGCACGATCTGCAGAA
GCCCTTGCTGAGTTTGTGAACAGTGAAGGAGGGACAAATGTCAAGATAGCTGCAGTTCCTTCAAATGTTGTGGTACTTACTCCAGAAAAC
TTTGATGAGATTGTGCTTGATGAGAAAAAAGATGTTCTGGTTGAGTTTTATGCCCCCTGGTGTGGTCATTGCAAAAGCCTTGCTCCCACT
TATGAAAAGGTGGCAACAGCATTTAAGTTGGAGGATCATGTGGTTATTGCTAATGTTGATGCAGACAAGTACAAAGATCTTGCTGAGAAA
TAT
Edits in Original Sequence 
(5')XXGTACGAAAAGCTCGGTGCGAGTTTCAAGAAAGCTAAAGCTGTTTTGATTGGAAAGGTGGACTGCGATGAGCATAAGAGCCTTTG
CAGCAAATATGGTGTTTCTGGCTACCCCACCATCCAATGGTTTCCGAAAGGTTCCTTGGAGCCCAAAAAGTATGAAGGTGCACGATCTGC
AGAAGCCCTTGCTGAGTTTGTGAACAGTGAAGGAGGGACAAATGTCAAGATAGCTGCAGTTCCTTCAAATGTTGTGGTACTTACTCCAGA
AAACTTTGATGAGATTGTGCTTGATGAGAAAAAAGATGTTCTGGTTGAGTTTTATGCCCCCTGGTGTGGTCATTGCAAAAGCCTTGCTCC
CACTTATGAAAAGGTGGCAACAGCATTTAAGTTGGAGGATCATGTGGTTATTGCTAATGTTGATGCAGACAAGTACAAAGATCTTGCTGA
GAAATAT(3')AT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan