ESTScan Details for Unigene SGN-U310483

Score 
195
Direction 
Forward
Predicted Peptide Sequence 
EDAKEELYSLVTVTEVPEGFKGLGTKVIDDDDE
Predicted Coding Sequence 
XXTGAAGATGCCAAGGAGGAGCTTTACTCCTTGGTTACTGTTACTGAAGTTCCCGAGGGATTCAAGGGGTTGGGTACTAAAGTTATTGAT
GATGATGATGAGTGA
Edits in Original Sequence 
(5')XXTGAAGATGCCAAGGAGGAGCTTTACTCCTTGGTTACTGTTACTGAAGTTCCCGAGGGATTCAAGGGGTTGGGTACTAAAGTTAT
TGATGATGATGATGAGTGA(3')ATAATTTTCTCAGTTTCTATGCCATTGCAATTTTGGCTGTATTATTAGATCATTTTGATGTTAGTTC
AGTTTTGACTCCCTTACTACAGGAGAATGACTTGAATGAATTATTATATCAGCCGTTTGCTTGTTTAAGACTGATTGTGGCATTCAATTC
GTATATTCTCCATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan