ESTScan Details for Unigene SGN-U310654

Score 
489
Direction 
Forward
Predicted Peptide Sequence 
SVPLKYSSTLSSLADSLYALSSLNGFRPLGLTDCKTLRLLPDRTEIRNSNSKQNSTGHMEMEIDNPKPNFKANNTQIKDEDLFKAAENGD
VSVFESLSDGQLLKALSLRNEDGRSLLHVAVSFAQTQVVKILSAAEPSVSGVNSTDEEGWAPLHSAASSGSVEIVEILLSRGADVNQKND
GGRTALHYAASKGRFKIAELLLSHGAKLNAKDKVGCTPLHRAASTGYSEVSELLIEGRAEVDDVDKAGQTPLMNAVICGNREAAXPTNKX
Predicted Coding Sequence 
XXATCTGTACCTTTAAAGTACTCTTCTACCCTTTCTTCTTTGGCAGACTCCCTTTATGCCCTTTCTTCCTTGAACGGATTCCGGCCTTTA
GGACTGACCGACTGCAAAACCCTACGTTTACTACCGGACCGGACTGAGATTCGGAACTCGAATAGTAAGCAAAATAGCACTGGACATATG
GAGATGGAAATCGACAATCCAAAGCCCAATTTCAAAGCTAACAACACCCAAATCAAAGACGAAGACCTCTTCAAAGCCGCTGAGAACGGC
GACGTTTCGGTCTTCGAATCCCTCTCCGACGGACAGCTCCTCAAAGCCCTCTCTCTCCGCAACGAAGATGGCCGTTCTCTCCTTCACGTT
GCCGTCTCCTTTGCCCAAACCCAGGTGGTGAAGATTCTATCAGCAGCAGAACCGTCTGTAAGTGGTGTAAATAGTACCGATGAGGAAGGC
TGGGCTCCTCTCCATTCTGCAGCAAGCAGCGGGAGTGTCGAGATTGTGGAGATTTTGCTGAGCAGAGGAGCTGATGTTAATCAGAAGAAT
GATGGTGGTCGCACAGCTCTCCACTATGCTGCTAGCAAGGGTCGGTTTAAAATAGCTGAACTTTTACTCTCTCATGGTGCAAAGCTCAAC
GCGAAGGACAAGGTTGGTTGTACCCCATTACATCGTGCAGCCAGCACAGGGTACTCAGAAGTATCTGAACTCTTAATTGAGGGAAGAGCT
GAGGTCGATGATGTTGATAAGGCGGGTCAAACTCCTCTTATGAATGCAGTGATATGCGGCAACAGAGAAGCTGCTXCTCCTACTAATAAG
AXX
Edits in Original Sequence 
(5')XXATCTGTACCTTTAAAGTACTCTTCTACCCTTTCTTCTTTGGCAGACTCCCTTTATGCCCTTTCTTCCTTGAACGGATTCCGGCC
TTTAGGACTGACCGACTGCAAAACCCTACGTTTACTACCGGACCGGACTGAGATTCGGAACTCGAATAGTAtAGCAAAATAGCACTGGAC
ATATGGAGATGGAAATCGACAATCCAAAGCCCAATTTCAAAGCTAACAACACCCAAATCAAAGACGAAGACCTCTTCAAAGCCGCTGAGA
ACGGCGACGTTTCGGTCTTCGAATCCCTCTCCGACGGACAGCTCCTCAAAGCCCTCTCTCTCCGCAACGAAGATGGCCGTTCTCTCCTTC
ACGTTGCCGTCTCCTTTGCCCAAACCCAGGTGGTGAAGATTCTATCAGCAGCAGAACCGTCTGTAAGTGGTGTAAATAGTACCGATGAGG
AAGGCTGGGCTCCTCTCCATTCTGCAGCAAGCAGCGGGAGTGTCGAGATTGTGGAGATTTTGCTGAGCAGAGGAGCTGATGTTAATCAGA
AGAATGATGGTGGTCGCACAGCTCTCCACTATGCTGCTAGCAAGGGTCGGTTTAAAATAGCTGAACTTTTACTCTCTCATGGTGCAAAGC
TCAACGCGAAGGACAAGGTTGGTTGTACCCCATTACATCGTGCAGCCAGCACAGGGTACTCAGAAGTATCTGAACTCTTAATTGAGGGAA
GAGCTGAGGTCGATGATGTTGATAAGGCGGGTCAAACTCCTCTTATGAATGCAGTGATATGCGGCAACAGAGAAGCTGCTXCTCCTACTA
ATAAGAXX(3')ACACGGAGCAAATGTAGATGTTGAGGACAATGAAGGATACACTGTACTCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan