ESTScan Details for Unigene SGN-U310674

Score 
219
Direction 
Forward
Predicted Peptide Sequence 
DEILNWLREIGRGDKIVIPXVSQLKGDSVHSLEEAIISQNFFIVHYEDIQEAXKAHLKSACQYCSSDTGEGCLKNPQGFKCHCSACNLEQ
KAKEQLKKENWRLKICKKIALELIFPNWENVEMYLRDKNGIDDNHQIVWANPRTEMLSDYLAYSQQWEPS
Predicted Coding Sequence 
GATGAGATTCTGAATTGGCTGCGTGAAATTGGCCGAGGCGACAAGATTGTCATCCCTGXGGTATCTCAACTCAAAGGTGATTCTGTACAT
AGCTTAGAGGAGGCCATCATAAGCCAGAACTTCTTCATTGTTCACTATGAGGACATCCAGGAAGCAGAXAAAGCTCATCTCAAGTCTGCT
TGTCAATATTGCAGTTCTGACACTGGTGAAGGTTGCTTAAAAAATCCACAGGGGTTCAAATGCCACTGCTCTGCCTGCAATTTGGAGCAG
AAAGCCAAAGAGCAGCTCAAGAAAGAAAATTGGCGACTAAAGATTTGCAAGAAGATTGCTTTGGAGCTTATTTTCCCAAATTGGGAGAAT
GTGGAAATGTACTTAAGAGATAAGAATGGAATAGATGATAATCATCAAATAGTATGGGCAAATCCCAGAACTGAAATGCTGAGTGATTAT
CTAGCTTATTCTCAACAATGGGAGCCATCX
Edits in Original Sequence 
(5')GATGAGATTCTGAATTGGCTGCGTGAAATTGGCCGAGGCGACAAGATTGTCATCCCTGXGGTATCTCAACTCAtAAGGTGATTCTG
TACATAGCTTAGAGGAGGCCtATCATAAGCCAGAACTTCTTCATTGTTCACTATGAGGACATCCAGGAAGCAGAXAAAGCTCATCTCAAG
TCTGCTTGTCAATATTGCAGTTCTGACACTGGTGAAGGTTGCTTAAAAAATCCACAGGGGTTCAAATGCCACTGCTCTGCCTGCAATTTG
GAGCAGAAAGCCAAAGAGCAGCTCAAGAAAGAAAATTGGCGACTAAAGATTTGCAAGAAGATTGCTTTGGAGCTTATTTTCCCAAATTGG
GAGAATGTGGAAATGTACTTAAGAGATAAGAATGGAATAGATGATAATCATCAAATAGTATGGGCAAATCCCAGAACTGAAATGCTGAGT
GATTATCTAGCTTATTCTCAACAATGGGAGCCATCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan