ESTScan Details for Unigene SGN-U310786

Score 
61
Direction 
Forward
Predicted Peptide Sequence 
GAAFRFLGRAYYGADPADSSLGQDGPTLINKWVLFSLHPIASLGLPKFIEDPLLHTFPFPPCFVQKDYRKLYDFINANSTFVLDEAERNG
IPRDEAAHNLVFATCFNTFGGIKVLFPNLMKWIGQAGVELHKKLVQEIRSAIESAGGTLTTQALENMPLTKSVVYETLRIEPPVPYQYGK
AKIDLTIESHDARFEVKRGGDVIRIPTLCD
Predicted Coding Sequence 
XXCGGAGCAGCTTTTCGCTTCTTAGGTCGAGCCTACTACGGCGCCGACCCGGCAGACTCCAGTCTCGGCCAAGACGGGCCTACGTTGATC
AACAAATGGGTCCTTTTCTCTCTTCATCCCATTGCCTCACTCGGGCTGCCTAAGTTTATTGAAGACCCTTTACTACACACCTTCCCCTTC
CCACCCTGTTTTGTGCAAAAAGATTACCGAAAACTCTACGATTTTATCAACGCGAACTCCACGTTCGTCCTGGACGAAGCTGAGAGAAAT
GGAATCCCACGTGATGAAGCGGCCCATAACCTCGTATTTGCTACGTGCTTCAATACCTTCGGGGGCATCAAAGTCCTCTTCCCCAACCTG
ATGAAATGGATCGGCCAAGCTGGAGTCGAACTCCACAAAAAATTAGTCCAAGAAATTCGATCAGCTATTGAGTCAGCCGGTGGCACTCTT
ACAACGCAAGCCCTCGAGAACATGCCTCTGACGAAGTCGGTTGTCTACGAGACTCTCAGGATCGAACCTCCGGTGCCTTACCAGTACGGG
AAGGCTAAGATTGATTTGACTATTGAGTCCCACGATGCCAGGTTTGAGGTAAAGAGAGGGGGAGATGTTATTCGGATACCAACCCTTTGC
GAC
Edits in Original Sequence 
(5')XXCGGAGCAGCTTTTCGCTTCTTAGGTCGAGCCTACTACGGCGCCGACCCGGCAGACTCCAGTCTCGGCCAAGACGGGCCTACGTT
GATCAACAAATGGGTCCTTTTCTCTCTTCATCCCATTGCCTCACTCGGGCTGCCTAAGTTTATTGAAGACCCTTTACTACACACCTTCCC
CTTCCCACCCTGTTTTGTGCAAAAAGATTACCGAAAACTCTACGATTTTATCAACGCGAACTCCACGTTCGTCCTGGACGAAGCTGAGAG
AAATGGAATCCCACGTGATGAAGCGGCCCATAACCTCGTATTTGCTACGTGCTTCAATACCTTCGGGGGCATCAAAGTCCTCTTCCCCAA
CCTGATGAAATGGATCGGCCAAGCTGGAGTCGAACTCCACAAAAAATTAGTCCAAGAAATTCGATCAGCTATTGAGTCAGCCGGTGGCAC
TCTTACAACGCAAGCCCTCGAGAACATGCCTCTGACGAAGTCGGTTGTCTACGAGACTCTCAGGATCGAACCTCCGGTGCCTTACCAGTA
CGGGAAGGCTAAGATTGATTTGACTATTGAGTCCCACGATGCCAGGTTTGAGGTAAAGAGAGGGGGAGATGTTATTCGGATACCAACCCT
TTGCGAC(3')GAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan