ESTScan Details for Unigene SGN-U310860

Score 
-17
Direction 
Reverse
Predicted Peptide Sequence 
MPGEGDPTSPRXGDSLGPPGPVREDFPNNGNRGIFGLQYPAGGNKKKGRAGVFYPSPGEEVGKPGIQNPGGGGGGRNGYGPGGXKLTTPR
V
Predicted Coding Sequence 
ATGCCCGGAGAGGGGGACCCAACCTCCCCCCGGGXGGGGGATTCCCTTGGCCCCCCTGGGCCGGTTAGGGAGGATTTTCCAAATAACGGG
AATAGGGGAATTTTTGGGTTGCAGTATCCTGCAGGGGGGAACAAAAAAAAGGGAAGGGCCGGGGTTTTTTATCCTTCCCCGGGGGAGGAA
GTGGGCAAACCGGGGATTCAAAACCCCGGGGGTGGGGGAGGGGGTAGGAATGGTTATGGGCCTGGGGGTAAXAAATTAACAACCCCGAGG
GTTTAA
Edits in Original Sequence 
TTTGGAAAAAGGGAAAAATACAAAAGGTTTGGGATTAGGGGAT(5')ATGCCCGGAGAGGGGGACCCAACCTCCCCCCGGGXGGGGGATT
CCCTTGGCCCCCCTGGGCCGGTTAGGGAGGATTTTCCAAATAACGGGAATAGGGGAATTTTTGGGTTGCAGTATCCTGCAGGGGGGAACA
AAAAAAAGGGAAGGGCCGGGGTTTTTTATCCTTCCCCGGGGGAGGAAGTGGGCAAACCGGGGATTCAAAACCCCGGGGGTGGGGGAGGGG
GTAGGAATGGTTATGGGCCTGGGGGTAAXAAATTAACAACCCCGAGGGTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan