ESTScan Details for Unigene SGN-U310935

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
LKEKFGDAIKEICQVYDEQIDETTVEAVDGHLDILRPAIKNYGGSIQVLSVEGGDCVVKYAGPESIGLGIKAAIREKFPDIANVVLTGLA
ACLESFGRSGLLMILIRWLKVKQQHNLWWAHCAGGRV
Predicted Coding Sequence 
CTCAAGGAAAAATTTGGTGATGCTATCAAGGAAATTTGCCAGGTGTATGATGAGCAAATAGACGAGACCACTGTTGAGGCAGTGGACGGT
CATCTGGACATACTGAGACCAGCCATTAAGAATTATGGTGGTAGCATACAAGTATTATCTGTTGAGGGAGGGGATTGCGTCGTAAAATAT
GCGGGGCCTGAGTCTATTGGATTGGGAATCAAAGCAGCAATAAGGGAGAAGTTCCCTGATATTGCGAATGTTGTTCTCACXGGACTAGCT
GCTTGCTTAGAAAGCTTTGGACGCTCTGGCTTGCTGATGATTTTGATACGGTGGCTCAAGGTTAAACAACAGCACAATCTCTGGTGGGCA
CACTGTGCAGGTGGCAGAGTGTAG
Edits in Original Sequence 
(5')CTCAAGGAAAAATTTGGTGATGCTATCAAGGAAATTTGCCAGGTGTATGATGAGCAAATAGACGAGACCACTGTTGAGGCAGTGGA
CGGTCATCTGGACATACTGAGACCAGCCATTAAGAATTATGGTGGTAGCATACAAGTATTATCTGTTGAGGGAGGGGATTGCGTCGTAAA
ATATGCGGGGCCTGAGTCTATTGGATTGGGAATCAAAGCAGCAATAAGGGAGAAGTTCCCTGATATTGCGAATGTTGTTCTCACXGGACT
AGCTGCTTGCTTAGAAAGCTTTGGACGCTCTGGCTTGCTGATGATTTTGATACGGTGGCTCAAGGTTAAACAACAGCACAATCTCTGGTG
GGCACACTGTGCAGGTGGCAGAGTGTAG(3')GATGTGTAAGATTATTATTAGCAGCTTAATTTACATGCTCTGGTCAGAATGTTTTGGG
CGCTACTGAAGGGGTTCTTGCCA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan