ESTScan Details for Unigene SGN-U311216

Score 
196
Direction 
Reverse
Predicted Peptide Sequence 
SCKARPCLIHTLAMCPETQPAIVHPGILPITVMLVTYRNYXAQNELLKTRILTITKPAEFHSLATGSRIIHLSPXSHPVFPQNMTVIAID
AAAGCQGHYHKKLLAVTLVIKGGKKTVSSKLLSHQYLGPMPNLEAXDSTAAFGISNPTXPLIVSGSFNPDNSDPFMALPGLLGESLLNSS
PDGKNKATPTHLPPAIFCPLYRSSQAYNWVHAYTAWMKHHIHLPNQYKPSLMKKSS
Predicted Coding Sequence 
AGCTGCAAAGCAAGGCCGTGTCTGATACATACACTTGCAATGTGTCCAGAAACTCAACCAGCTATAGTTCACCCCGGCATTTTGCCTATC
ACGGTAATGCTTGTAACTTACAGAAACTATAXAGCCCAAAATGAGCTCCTAAAAACAAGGATATTAACAATTACTAAGCCAGCGGAATTT
CATTCTCTTGCAACAGGATCAAGAATAATTCACCTTTCACCAXTGAGTCACCCAGTTTTTCCCCAAAATATGACTGTTATTGCAATTGAT
GCTGCCGCAGGTTGCCAAGGGCATTACCACAAGAAATTGCTGGCAGTGACTTTGGTCATCAAAGGTGGAAAAAAAACTGTGTCATCAAAG
TTGCTTAGTCATCAATATCTTGGACCCATGCCAAATCTTGAAGCAXCAGACTCAACTGCAGCATTTGGGATTAGTAATCCAACAATXCCG
CTGATTGTCAGTGGTAGTTTCAATCCGGACAACTCTGATCCGTTTATGGCTTTGCCGGGCCTGCTTGGAGAGAGCCTTCTCAATAGTTCC
CCAGATGGGAAGAATAAGGCCACXCCAACACATTTACCTCCTGCAATCTTCTGCCCACTGTACAGAAGCTCCCAAGCTTACAATTGGGTC
CATGCATACACTGCTTGGATGAAACATCATATTCATCTTCCCAACCAGTACAAGCCTTCTCTGATGAAGAAATCTTCC
Edits in Original Sequence 
(5')AGCTGCAAAGCAAGGCCGTGTCTGATACATACACTTGCAATGTGTCCAGAAACTCAACCAGCTATAGTTCACCCCGGCATTTTGCC
TATCACGGTAATGCTTGTAACTTACAGAAACTATAXAGCCCAAAATGAGCTCCTAAAAACAAGGATATTAACAATTACTAAGCCAGCGGA
ATTTCATTCTCTTGCAACAGGATCAAGAATAATTCACCTTTCACCAXTGAGTCACCCAGTTTTTCCCCAAAATATGACTGTTATTGCAcA
TTGATGCTGCCGCAGGTTGCCAAGGGCATTACCACAAGAAATTGCTGGCAGTGACTTTGGTCATCAAAGGTGGAAAAAAAACTGTGTCAT
CAAAGTTGCTTAGTCATCAATATCTTGGACCCATGCCAAATCTTGAAGCAXCAGACTCAACTGCAGCATTTGGGATTAGTAATCCAACAA
TXCCGCTGATTGTCAGTGGTAGTTTCAATCCGGACAACTCTGATCCGTTTATGGCTTTGCCGGGCCTGCTTGGAGAGAGCCTTCTCAATA
GTTCCCCAGATGGGAAGAATAAGGCCACXCCAACACATTTACCTCCTGCAATCTTCTGCCCACTGTACAGAAGCTCCCAAGCTTACAATT
GGGTCCATGCATACACTGCTTGGATGAAACATCATATTCATCTTCCCAACCAGTACAAGCCTTCTCTGATGAAGAAATCTTCC(3')GTA
CAAGCCTTCTCTGATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan