ESTScan Details for Unigene SGN-U311240

Score 
364
Direction 
Forward
Predicted Peptide Sequence 
QGWKPARAFELLVEMVKKDLLPDTYTYRPLISGLCLAGRVTEAREFFDNXPSEALQAKRDVLFCPSAGYCKEGRLKDALKACREMVESGI
HMDLICYAVLICGTLKQHDADKLLCVMKEMHDQGLKPDDVIYTSMIDAYGKAGDLKTALGYWDIMVHENCIPNIVTYTVMINGLCKAGLI
DKAENLCKEMLASGLIPNQITYGCFLDQLT
Predicted Coding Sequence 
CAAGGATGGAAACCAGCAAGGGCCTTTGAGTTGCTTGTTGAGATGGTGAAAAAGGATCTTTTACCTGATACATATACTTATAGGCCTCTG
ATAAGTGGCCTTTGTCTGGCAGGTAGAGTAACTGAAGCCAGAGAATTCTTTGACAACAXTCCATCGGAAGCATTGCAAGCTAAACGAGAT
GTGCTTTTCTGCCCTTCTGCTGGTTACTGTAAGGAAGGAAGGTTGAAGGATGCACTGAAAGCCTGTCGGGAAATGGTGGAAAGTGGAATA
CACATGGACCTTATATGTTATGCTGTACTTATATGTGGAACTTTAAAACAGCATGATGCTGATAAATTATTGTGTGTTATGAAGGAGATG
CATGACCAGGGATTGAAGCCTGATGATGTAATTTACACAAGCATGATTGATGCATATGGTAAAGCTGGAGATTTAAAGACTGCGTTGGGA
TATTGGGACATAATGGTGCATGAAAACTGCATTCCAAATATTGTGACGTATACTGTAATGATTAATGGTCTGTGTAAGGCAGGATTGATT
GACAAGGCTGAGAATCTTTGTAAAGAAATGCTAGCTAGTGGTCTGATTCCTAATCAGATTACTTATGGTTGCTTCCTTGATCAGCTCACC
Edits in Original Sequence 
(5')CAAGGATGGAAACCAGCAAGGGCCTTTGAGTTGCTTGTTGAGATGGTGAAAAAGGATCTTTTACCTGATACATATACTTATAGGCC
TCTGATAAGTGGCCTTTGTCTGGCAGGTAGAGTAACTGAAGCCAGAGAATTCTTTGACAACAXTCCATCGGAAGCATTGCAAGCTAAACG
AGATGTGCTTTTCTGCCCTTCTGCaTGGTTACTGTAAGGAAGGAAGGTTGAAGGATGCACTGAAAGCCTGTCGGGAAATGGTGGAAAGTG
GAATACACATGGACCTTATATGTTATGCTGTACTTATATGTGGAACTTTAAAACAGCATGATGCTGATAAATTATTGTGTGTTATGAAGG
AGATGCATGACCAGGGATTGAAGCCTGATGATGTAATTTACACAAGCATGATTGATGCATATGGTAAAGCTGGAGATTTAAAGACTGCGT
TGGGATATTGGGACATAATGGTGCATGAAAACTGCATTCCAAATATTGTGACGTATACTGTAATGATTAATGGTCTGTGTAAGGCAGGAT
TGATTGACAAGGCTGAGAATCTTTGTAAAGAAATGCTAGCTAGTGGTCTGATTCCTAATCAGATTACTTATGGTTGCTTCCTTGATCAGC
TCACC(3')CAGAGAAGGGTGCATGGTGAAGCAATGAACTACACATGCAATGGTCAGAGGTCTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan