ESTScan Details for Unigene SGN-U311255

Score 
682
Direction 
Forward
Predicted Peptide Sequence 
MSSRLALHHGRHLSTSAAAAATAAVEAAGASTATSTKPSTISTSRAKSQLRYVYDPDKALEIYSSVSPNYTSPLSSRYTQEYTVRRLAKS
HRFSDIENFLESHKNDPKITQEPFLSSLIRSYGLAGMFDHALKTFNEMDDLGTPRSTVSFNALLSACNSSKNFGRAPELFDEVPQRYGLS
PDKFSYGNLIKAYCEMGSPESAAGKAEGNGG
Predicted Coding Sequence 
ATGTCTTCCCGTCTCGCCCTCCACCACGGCCGCCACCTTTCAACTTCCGCCGCCGCCGCTGCCACCGCAGCCGTCGAAGCAGCAGGGGCT
TCTACTGCCACCTCCACAAAGCCGTCTACCATCAGCACTTCCAGAGCCAAATCACAACTCAGATACGTCTACGACCCCGACAAAGCCCTC
GAAATCTACTCTTCAGTCTCCCCTAACTATACCTCTCCGCTCTCCTCTCGCTACACCCAAGAGTACACCGTCCGCCGCCTCGCCAAATCC
CACAGATTCTCTGACATCGAAAACTTCCTCGAATCTCACAAAAATGACCCCAAAATCACTCAAGAACCATTCCTTTCTTCCCTCATTCGA
TCCTATGGTCTTGCTGGTATGTTTGATCATGCCCTCAAAACTTTTAATGAAATGGATGATCTGGGTACCCCCAGGTCAACTGTTTCCTTC
AATGCTCTCCTTTCTGCTTGCAATTCGTCCAAAAATTTTGGACGAGCCCCTGAGCTGTTCGATGAAGTGCCTCAAAGATATGGGCTTTCG
CCGGATAAGTTTTCATATGGGAATCTGATCAAGGCTTATTGTGAAATGGGATCGCCCGAATCAGCXGCTGGAAAGGCTGAAGGAAATGGA
GGA
Edits in Original Sequence 
GCTTAAATTCCCCTAAAACTTTCCCTTTATTTACGAAGCCATGCCTTCCCCCTTTCATTACTAGTTACGAATCCTCAAAAGATCCATAAC
AAAACACCTAAAACCCTAGAA
(5')ATGTCTTCCCGTCTCGCCCTCCACCACGGCCGCCACCTTTCAACTTCCGCCGCCGCCGCTGCCAC
CGCAGCCGTCGAAGCAGCAGGGGCTTCTACTGCCACCTCCACAAAGCCGTCTACCATCAGCACTTCCAGAGCCAAATCACAACTCAGATA
CGTCTACGACCCCGACAAAGCCCTCGAAATCTACTCTTCAGTCTCCCCTAACTATACCTCTCCGCTCTCCTCTCGCTACACCCAAGAGTA
CACCGTCCGCCGCCTCGCCAAATCCCACAGATTCTCTGACATCGAAAACTTCCTCGAATCTCACAAAAATGACCCCAAAATCACTCAAGA
ACCATTCCTTTCTTCCCTCATTCGATCCTATGGTCTTGCTGGTATGTTTGATCATGCCCTCAAAACTTTTAATGAAATGGATGATCTGGG
TACCCCCAGGTCAACTGTTTCCTTCAATGCTCTCCTTTCTGCTTGCAATTCGTCCAAAAATTTTGGACGAGCCCCTGAGCTGTTCGATGA
AGTGCCTCAAAGATATGGGCTTTCGCCGGATAAGTTTTCATATGGGAATCTGATCAAGGCTTATTGTGAAATGGGATCGCCCGAATCAGC
XGCTGGAAAGGCTGAAGGAAATGGAGGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan