ESTScan Details for Unigene SGN-U311291

Score 
287
Direction 
Forward
Predicted Peptide Sequence 
RRYPFESEKKRGELPNFLSFKNFXFLMERKDNNQAKAPQGEAARILTEFLEVAISCIIFLKGVYPHGAFERRKYMNVVVHRARHPQLKDY
IHSSVNGLLPFIQKGLVERVVVIFFDNEDFPIERFVFKVNLNLSYGSKVEQSDLEFSLRSFLIKLPVSESLTKLLPRGESG
Predicted Coding Sequence 
AGGAGATACCCTTTTGAGTCCGAAAAGAAAAGAGGCGAATTGCCGAACTTTCTTTCCTTTAAAAATTTTTTXTTTTTGATGGAGCGCAAG
GATAATAATCAAGCAAAGGCTCCCCAAGGAGAAGCTGCTAGAATATTAACAGAATTTCTGGAGGTTGCTATCTCCTGCATAATTTTCCTC
AAAGGAGTTTATCCACATGGGGCTTTCGAGAGGCGGAAATACATGAATGTGGTGGTTCACAGAGCCAGACATCCTCAGCTTAAAGATTAC
ATCCATTCCTCTGTCAATGGGCTTCTTCCCTTCATACAAAAGGGATTGGTGGAGAGGGTGGTGGTAATTTTCTTTGATAATGAGGATTTC
CCCATTGAGAGATTTGTTTTTAAGGTTAATTTAAACCTTTCCTACGGTTCCAAGGTGGAACAATCTGACCTGGAGTTTTCTCTTAGATCA
TTCTTGATCAAGCTTCCTGTTTCTGAGTCTCTTACTAAGCTTCTTCCCCGAGGTGAATCTGGA
Edits in Original Sequence 
(5')AGGAGATACCCTTTTGAGTCCGAAAAGAAAAGAGGCGAATTGCCGAACTTTCTTTCCTTTAAAAATTTTTTXTTTTTGATGGAGCG
CAAGGATAATAATCAAGCAAAGGCTCCCCAAGGAGAAGCTGCTAGAATATTAACAGAATTTCTGGAGGTTGCTATCTCCTGCATAATTTT
CCTCAAAGGAGTTTATCCACATGGGGCTTTCGAGAGGCGGAAATACATGAATGTGGTGGTTCACAGAGCCAGACATCCTCAGCTTAAAGA
TTACATCCATTCCTCTGTCAATGGGCTTCTTCCCTTCATACAAAAGGGATTGGTGGAGAGGGTGGTGGTAATTTTCTTTGATAATGAGGA
TTTCCCCATTGAGAGATTTGTTTTTAAGGTTAATTTAAACCTTTCCTACGGTTCCAAGGTGGAACAATCTGACCTGGAGTTTTCTCTTAG
ATCATTCTTGATCAAGCTTCCTGTTTCTGAGTCTCTTACTAAGCTTCTTCCCCGAGGTGAATCTGGA(3')ATTCTTTCTTTCTTTTTTT
CTTTTTTCAAAATTTTATGCGTTGTGTGAATACTAATGAAGCTTAAAATATTACCAACTTTCAAACTCAATCATGAAAAGATGGGGGAGA
AATATACTAATGTGCTTTACGCTTGAGCAACGTCTAGATGATTCAAATAGCCGTATG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan