ESTScan Details for Unigene SGN-U311444

Score 
501
Direction 
Forward
Predicted Peptide Sequence 
IAENPKVNGISTQTQAGVLKFVWARRLAENFDLEQXMASSSDHKATVIDGKAVAHTIRSEVADEVRQLSQKYGKVPGLAVVIVGHRKDSQ
SYVSMKRKACAEVGIKSFDINLPEQVSEAELISKVHELNANPDVHGILVQLPLPKHVNEEKVLGEISLEKDVDGFHPLNIGKLAMKGREP
LFLPCTPKGCLELLSRSGISIKGKKAVVVGRSNIVGLPVSLLLLKEDATVTIVHSRTKEPENIIRE
Predicted Coding Sequence 
ATAGCTGAAAATCCTAAAGTGAACGGAATCTCCACTCAAACTCAAGCAGGAGTACTGAAATTTGTGTGGGCAAGAAGACTAGCTGAAAAT
TTTGATTTGGAGCAAGXTATGGCATCGTCGTCGGATCACAAGGCAACTGTCATCGACGGCAAAGCAGTAGCTCATACTATACGGTCCGAA
GTTGCCGATGAAGTTCGTCAACTGTCCCAGAAGTACGGCAAGGTCCCAGGATTGGCCGTGGTCATAGTGGGACATAGGAAGGACTCTCAA
AGCTACGTGAGTATGAAGAGGAAGGCATGTGCTGAGGTTGGGATCAAGTCCTTTGACATCAACCTTCCAGAGCAAGTGTCTGAAGCCGAA
TTAATCAGCAAGGTCCATGAGCTGAATGCAAATCCAGATGTTCATGGTATATTGGTGCAGCTTCCACTTCCAAAGCATGTAAATGAAGAG
AAAGTTTTGGGTGAAATTAGCTTGGAAAAAGATGTGGATGGCTTTCACCCTTTAAATATAGGCAAGCTTGCAATGAAAGGCAGAGAGCCT
CTATTCCTTCCATGCACCCCTAAGGGCTGTCTTGAGCTTCTCTCACGTAGTGGCATTAGCATAAAGGGCAAGAAGGCAGTTGTGGTAGGA
CGAAGCAATATTGTTGGATTACCTGTTTCCCTACTACTACTCAAAGAAGACGCCACTGTCACTATAGTGCATTCCCGTACCAAGGAACCA
GAGAATATTATCCGTGAG
Edits in Original Sequence 
GAAACATAGCTGAAAATCCTAAAGTGAACGGAATCTCCA(5')ATAGCTGAAAATCCTAAAGTGAACGGAATCTCCACTCAAACTCAAGC
AGGAGTACTGAAATTTGTGTGGGCAAGAAGACTAGtCTGAAAATTTTGATTTGGAGCAAGXTATGGCATCGTCGTCGGATCACAAGGCAA
CTGTCATCGACGGCAAAGCAGTAGCTCATACTATACGGTCCGAAGTTGCCGATGAAGTTCGTCAACTGTCCCAGAAGTACGGCAAGGTCC
CAGGATTGGCCGTGGTCATAGTGGGACATAGGAAGGACTCTCAAAGCTACGTGAGTATGAAGAGGAAGGCATGTGCTGAGGTTGGGATCA
AGTCCTTTGACATCAACCTTCCAGAGCAAGTGTCTGAAGCCGAATTAATCAGCAAGGTCCATGAGCTGAATGCAAATCCAGATGTTCATG
GTATATTGGTGCAGCTTCCACTTCCAAAGCATGTAAATGAAGAGAAAGTTTTGGGTGAAATTAGCTTGGAAAAAGATGTGGATGGCTTTC
ACCCTTTAAATATAGGCAAGCTTGCAATGAAAGGCAGAGAGCCTCTATTCCTTCCATGCACCCCTAAGGGCTGTCTTGAGCTTCTCTCAC
GTAGTGGCATTAGCATAAAGGGCAAGAAGGCAGTTGTGGTAGGACGAAGCAATATTGTTGGATTACCTGTTTCCCTACTACTACTCAAAG
AAGACGCCACTGTCACTATAGTGCATTCCCGTACCAAGGAACCAGAGAATATTATCCGTGAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan