ESTScan Details for Unigene SGN-U311566

Score 
359
Direction 
Forward
Predicted Peptide Sequence 
MATVRAVSEVDDRDVLEETLDEMVSNGILSPELAIQVLVQFDKSMTEALESQVKSKVSIKGHLHTYRFCDNVWTFILQDAHFKSDECQET
VSRVKIVACDRSCSHSEKAAYWADIEXILAADVTYLPDGAKAGXEELAEEIWKLIHVVVFVSEGETGTLIV
Predicted Coding Sequence 
ATGGCGACXGTTCGAGCTGTATCGGAGGTCGACGATCGGGATGTGCTTGAGGAGACGCTTGATGAGATGGTCTCTAACGGCATCCTCAGC
CCCGAGCTCGCTATTCAAGTTCTGGTTCAATTTGATAAGTCAATGACTGAAGCTCTTGAATCTCAAGTGAAGAGCAAAGTTTCAATTAAG
GGACATCTCCACACCTATAGATTCTGTGACAATGTTTGGACTTTCATCTTACAAGATGCTCATTTCAAGAGTGATGAATGTCAAGAGACT
GTCAGCCGTGTTAAGATAGTGGCATGTGATCGAAGCTGCTCACACAGTGAGAAAGCTGCATACTGGGCCGATATTGAGXTAATATTAGCT
GCTGATGTCACCTATTTGCCAGATGGTGCAAAAGCTGGTAXAGAGGAGTTGGCGGAAGAGATATGGAAGCTCATTCATGTAGTTGTATTT
GTAAGTGAGGGGGAAACTGGAACTCTCATTGTATAA
Edits in Original Sequence 
GTAACTTTCTCACACAGCTCTCAGTAACTCTCTCTTGTGCGCCTCGTCTTCAATCGAAAAGCCTTTGAGAT(5')ATGGCGACXGTTCGA
GCTGTATCGGAGGTCGACGATCGGGATGTGCTTGAcGGAGACGCTTGATGAGATGGTCTCTAACGGCATCCTCAGCCCCGAGCTCGCTAT
TCAAGTTCTGGTTCAATTTGATAAGTCAATGACTGAAGCTCTTGAATCTCAAGTGAAGAGCAAAGTTTCAATTAAGGGACATCTCCACAC
CTATAGATTCTGTGACAATGTTTGGACTTTCATCTTACAAGATGCTCATTTCAAGAGTGATGAATGTCAAGAGACTGTCAGCCGTGTTAA
GATAGTGGCATGTGAcTCGAAGCTGCTCACACAGTGAGAAAGCTGCATACTGGGCCGATATTGAGXTAATATTAGCTGCTGATGTCACCT
ATTTGCCAGATGGTGCAAAAGaCTGGTAXAGAGGAGTTGGCGGAAGAGATATGGAAGCTCATTCATGTAGTTGTATTTGTAAGTGAGGGG
GAAACTGGAACTCTCATTGTATAA(3')AATCCCAGATCATTGTAAACTGAGTGTTTCTTGACTACTTGACATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan