ESTScan Details for Unigene SGN-U311823

Score 
423
Direction 
Forward
Predicted Peptide Sequence 
MDFESVNILLEKEGGPYESTVDSMPQRYFEPFVVQGLKVDLIERGRIVCSMVVPSRLLNTGTSLHGGATATLVDMVGSAVIYTVGSPVTG
VSVEINVSYLDGAYVGDEIEIEAKTLRVGKAIAVVSVELKNKKTGKIIAQGXSYKVLSFIKQVVRNPLFGTLCNIDGRLASKCLSLNLNK
KLSCLLKARFYVVFIRVQEAXAAYLVSDELNFHARLLLGHFSLNSWSLILHFLSKAAPHDANNQELGLQIDAXGPRIFFERKC
Predicted Coding Sequence 
ATGGACTTTGAATCAGTGAACATATTGCTAGAGAAAGAAGGAGGCCCATATGAATCAACAGTGGATTCTATGCCCCAGAGATACTTTGAA
CCCTTTGTAGTTCAAGGCCTCAAGGTTGACCTCATTGAACGGGGTCGTATTGTCTGCTCCATGGTTGTTCCTTCTCGCCTTCTGAATACT
GGGACTTCTTTGCATGGTGGGGCGACAGCCACGCTGGTGGACATGGTGGGTTCAGCTGTCATATACACCGTGGGGTCTCCGGTGACTGGA
GTTTCCGTTGAGATCAATGTTTCCTACCTGGATGGTGCCTATGTTGGTGATGAAATTGAGATTGAGGCAAAGACATTACGAGTTGGAAAG
GCAATTGCTGTTGTCAGTGTTGAGTTGAAGAACAAAAAGACAGGTAAAATTATTGCTCAAGGGCXGTCATACAAAGTACTTAGCTTTATC
AAGCAAGTTGTGAGGAACCCGCTCTTTGGTACCTTGTGCAATATTGACGGCAGATTGGCTTCTAAATGTCTGAGCCTCAACTTAAACAAG
AAACTTTCATGTCTATTGAAGGCTAGGTTTTATGTCGTATTCATTCGGGTTCAAGAAGCTGXTGCAGCTTATTTGGTGAGTGATGAATTG
AACTTTCATGCAAGACTACTACTTGGTCATTTTAGTTTAAATTCTTGGTCATTAATACTTCATTTCCTTTCAAAAGCAGCACCGCATGAT
GCTAACAATCAAGAACTCGGTCTGCAGATAGATGCTXTAGGTCCCCGTATCTTCTTCGAAAGGAAATGCTAA
Edits in Original Sequence 
GAATAATATCCCTTTAAAATCAGATTCCAAA(5')ATGGACTTTGAATCAGTGAACATATTGCTAGAGAAAGAAGGAGGCCCATATGAAT
CAACAGTGGATTCTATGCCCCAGAGATACTTTGAACCCTTTGTAGTTCAAGGCCTCAAGGTTGACCTCATTGAACGGGGTCGTATTGTCT
GCTCCATGGTTGTTCCTTCTCGCCTTCTGAATACTGGGACTTCTTTGCATGGTGGGGCGACAGCCACGCTGGTGGACATGGTGGGTTCAG
CTGTCATATACACCGTGGGGTCTCCGGTGACTGGAGTTTCCGTTGAGATCAATGTTTCCTACCTGGATGGTGCCTATGTTGGTGATGAAA
TTGAGATTGAGGCAAAGACATTACGAGTTGGAAAGGCAATTGCTGTTGTCAGTGTTGAGTTGAAGAACAAAAAGACAGGTAAAATTATTG
CTCAAGGGCXGTCATACAAAGTACTTAGCTTTATCAAGCAAGTTGTGAGGAACCCGCTCTTTGGTACCTTGTGCAATATTGACGGCAGAT
TGGCTTCTAAATGTCTGAGCCTCAACTTAAACAAGAAACTTTCATGTCTATTGAAGGCTAGGTTTTATGTCGTATTCATTCGGGTTCAAG
AAGCTGXTGCAGCTTATTTGGTGAGTGATGAATTGAACTTTCATGCAAGACTACTACTTGGTCATTTTAGTTTAAATTCTTGGTCATTAA
TACTTCATTTCCTTTCAAAAGCAGCACCGCATGATGCTAACAATCAAGAACTCGGTCTGCAGATAGATGCTXTAGGTCCCCGTATCTTCT
TCGAAAGGAAATGCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan