ESTScan Details for Unigene SGN-U311829

Score 
258
Direction 
Forward
Predicted Peptide Sequence 
RKTLDPSGKDHTIILVLPSGIYHYKFIVDGSVKYIPNLPYEADGMGHVCNLLDVHEDVPENFEGVREFEAPPFFDTAIVIVFXSDEDFAK
DPVEVPPQX
Predicted Coding Sequence 
XXAAGGAAGACACTTGACCCATCTGGTAAAGATCACACCATTATCTTGGTACTGCCATCAGGAATATACCATTACAAGTTTATTGTTGAT
GGCAGTGTGAAATATATCCCAAATCTTCCATATGAAGCTGATGGCATGGGGCATGTTTGCAATCTTCTTGATGTTCATGAGGATGTCCCG
GAGAACTTCGAAGGTGTGAGGGAGTTTGAAGCGCCACCATTTTTTGACACAGCTATAGTCATAGTTTTCTTXAGTGATGAAGATTTTGCA
AAGGACCCAGTGGAAGTTCCACCTCAACXX
Edits in Original Sequence 
(5')XXAAGGAAGACACTTGACCCATCTGGTAAAGATCACACCATTATCTTGGTACTGCCATCAGGAATATACCATTACAAGTTTATTGT
TGATGGCAGTGTGAAATATATCCCAAATCTTCCATATGAAGCTGATGGCATGGGGCATGTTTGCAATCTTCTTGATGTTCATGAGGATGT
CCCGGAGAACTTCGAAGGTGTGAGGGAGTTTGAAGCGCCACCATTTTTTGACACgAGCTATAGTCATAGTTTTCTTXAGTGATGAAGATT
TTGCAAAGGACCCAGTGGAAGTTCCACCTCAACXX(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan