ESTScan Details for Unigene SGN-U311835

Score 
387
Direction 
Forward
Predicted Peptide Sequence 
HQAPFRNMLFYGPPGTGKTMAARELAQRSGLDYALMTGGDVAPLGSQAVTKIHQLFDWSKKSKKGLLLFIDEADAFLCERNKIYMSEAHR
SALNALLFRTGDQSKDIVLALATNRPGDLDTAVADRIDEVLEFPLPX
Predicted Coding Sequence 
CATCAAGCACCATTCCGAAACATGCTTTTCTATGGCCCTCCAGGAACAGGAAAGACGATGGCTGCAAGAGAGCTTGCTCAGAGATCTGGT
CTTGACTATGCATTGATGACTGGAGGAGATGTTGCGCCACTGGGGTCGCAGGCTGTTACTAAAATACATCAGTTGTTTGATTGGTCAAAA
AAGTCGAAGAAGGGTTTATTGCTATTCATTGATGAAGCAGATGCATTTTTGTGCGAGCGGAACAAAATATATATGAGTGAAGCTCACAGG
AGTGCTCTCAATGCCCTTCTGTTCCGCACAGGCGACCAGTCCAAAGACATAGTTCTTGCTTTGGCAACTAACCGTCCAGGAGATCTTGAC
ACTGCTGTGGCTGACCGCATTGATGAAGTTCTGGAATTTCCTTTGCCTGXX
Edits in Original Sequence 
(5')CATCAAGCACCATTCCGAAACATGCTTTTCTATGGCCCTCCAGGAACAGGAAAGACGATGGCTGCAAGAGAGCTTGCTCAGAGATC
TGGTCTTGACTATGCATTGATGACTGGAGGAGATGTTGCGCCACTGGGGTCGCAGGCTGTTACTAAAATACATCAGTTGTTTGATTGGTC
AAAAAAGTCGAAGAAGGGTTTATTGCTATTCATTGATGAAGCAGATGCATTTTTGTGCGAGCGGAACAAAATATATATGAGTGAAGCTCA
CAGGAGTGCTCTCAATGCCCTTCTGTTCCGCACAGGCGACCAGTCCAAAGACATAGTTCTTGCTTTGGCAACTAACCGTCCAGGAGATCT
TGACACTGCTGTGGCTGACCGCATTGATGAAGTTCTGGAATTTCCTTTGCCTGXX(3')GAAGTTCTGGAATTTCCTTTGCCTGGCGAAG
ATGAACGCTTCAAGATGCTCAAGCTCTACCTTGACAAGTATATAGCTCAGGGTGGAGAAAGAAATCAAGCTTGGTCTCCATTTCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan