ESTScan Details for Unigene SGN-U311859

Score 
313
Direction 
Forward
Predicted Peptide Sequence 
LEQFMESPLLKPMVTLSGTAEEGAVGPPLGLVDIGICESAYLFRVALPGARGSESKLKCNIQLNGRVHIEGVITESQFMKNCSKVFEMKV
QQLCPTGPFSVSFNLPGPVXPKVMLFFFQGRWYFRGGCTEVQNTTSXQQKAGLKNGMIAGPFL
Predicted Coding Sequence 
XCATTGGAACAGTTTATGGAGTCTCCACTATTGAAACCAATGGTTACTTTATCTGGAACTGCCGAAGAAGGTGCCGTTGGACCTCCTCTA
GGTTTGGTTGACATAGGTATCTGTGAAAGTGCCTATCTTTTTCGTGTTGCCCTTCCTGGTGCTAGGGGTAGCGAGAGTAAGTTGAAATGC
AACATACAACTCAATGGACGGGTTCACATAGAGGGAGTGATTACCGAGTCTCAATTCATGAAGAATTGTTCTAAGGTGTTTGAAATGAAA
GTACAGCAGCTTTGTCCTACTGGGCCTTTCAGTGTCTCTTTCAATTTGCCTGGACCTGTAGAXCCCAAGGTTATGCTCTTTTTCTTTCAA
GGCAGGTGGTATTTTAGAGGTGGTTGTACTGAAGTTCAGAATACCACATCTXATCAGCAGAAGGCTGGTTTGAAAAATGGTATGATTGCT
GGTCCTTTCCTX
Edits in Original Sequence 
(5')XCATTGGAACAGTTTATGGAGTCTCCACTATTGAAACCAATGGTTACTTTATCTGGAACTGCCGAAGAAGGTGCCGTTGGACCTCC
TCTAGGTTTGGTTGACATAGGTATCTGTGAAAGTGCCTATCTTTTTCGTGTTGCCCTTCCTGGTGCTAGGGGTAGCGAGAGTAAGTTGAA
ATGCAACATACAACTCAATGGACGGGTTCACATAGAGGGAGTGATTACCGAGTCTCAATTCATGAAGAATTGTTCTAAGGTGTTTGAAAT
GAAAGTACAGCAGCTTTGTCCTACTGGGCCTTTCAGTGTCTCTTTCAATTTGCCTGGACCTGTAGAXCCCAAGGTTATGCTCTTTTTCTT
TCAAGGCAGGTGGTATTTTAGAGGTGGTTGTACTGAAGTTCAGAATACCACATCTXATCAGCAGAAGGCTGGTTTGAAAAATGGTATGAT
TGCTGGTCCTTTCCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan