ESTScan Details for Unigene SGN-U311903

Score 
-8
Direction 
Reverse
Predicted Peptide Sequence 
MTTILMEQFNNVSEAIDASSLDYIQQVLINLHSNFVLNNIPHHLYRDEPLILIASLRGSGLMKYNVGNPRTCMSRANSYSLSX
Predicted Coding Sequence 
ATGACAACAATACTAATGGAGCAGTTTAACAATGTTTCTGAAGCCATTGACGCTTCTTCTTTAGACTACATCCAGCAGGTCCTTATTAAC
CTGCATTCAAATTTCGTTCTCAATAATATCCCGCATCATCTGTATAGGGATGAGCCCCTCATTCTTATTGCATCTTTGCGTGGATCTGGA
CTGATGAAATATAATGTCGGTAACCCACGAACCTGCATGTCACGGGCAAATTCATATTCATTATCTGXX
Edits in Original Sequence 
ACAAAAGACCAGGCGTATTGGCCATTTTCCAGTACACAGTTAACAGCTGCAAACAGCAGGGTTCTTCAAGACCACTAGCAGTATAGCACA
TCAAGCTCTAGATGTTTTTGAACTATACGTGGCTACAAAATTTTACTACAGCACGATGACAACAATACTAATGGA
(5')ATGACAACAAT
ACTAATGGAGCAGTTTAACAATGTTTCTaGAAGCCATTGACGCTTCTTCTTTAGACTACATCCAGCAGGTCCTTaATTAACCTGCATTCA
AATTTCGTTCTCAATAATATCCCGCATCATCTGTATAGGGATGAGCCCCTCAgTTCTTATTGCATCTTTGCGTGGATCTGGACTGATGAA
ATATAATGTCGGTAACCCACGAACCTGCATGTCACGGGCAAATTCATATTCATTATCTGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan