ESTScan Details for Unigene SGN-U311910

Score 
230
Direction 
Forward
Predicted Peptide Sequence 
REKXATFTEFHEEEEEEKTLIFRQMGVDYYKILQVDRNAKEDDLKRAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAVY
DQYGEEGLKGQVPPPSAYASTSDGGGPTMFRFNPRNPDDIFSEFFGFSSPFGGMGGMEKYGWPGSAGSSFSRGMFSDDIFASFRSATSEG
SSGSVPRKGAAIGGHCPVVWEICT
Predicted Coding Sequence 
XGTAGAGAGAAGGXTGCTACATTTACAGAATTCCACGAGGAGGAGGAGGAGGAGAAAACTCTCATATTTAGGCAAATGGGGGTGGACTAC
TATAAAATCCTTCAGGTAGACCGCAATGCCAAAGAAGACGACCTCAAGAGAGCCTATCGCAAACTCGCTATGAAATGGCACCCCGATAAA
AACCCTAACAATAAAAAGGATGCCGAAGCAAAATTCAAACAAATCTCCGAAGCCTACGATGTGTTGAGTGATCCGCAGAAGAGGGCAGTA
TATGACCAGTACGGAGAAGAGGGATTAAAGGGGCAGGTTCCTCCGCCTAGTGCATACGCCTCTACGTCGGATGGGGGTGGTCCCACCATG
TTCCGGTTCAATCCCCGCAACCCCGATGACATTTTCTCCGAATTCTTTGGGTTCTCGAGTCCCTTTGGGGGAATGGGCGGGATGGAAAAA
TATGGGTGGCCCGGTTCTGCTGGATCAAGCTTCTCCAGAGGTATGTTCAGCGATGATATCTTCGCATCGTTTAGGAGTGCCACCAGCGAA
GGCTCCTCTGGCAGTGTCCCCCGGAAAGGCGCCGCCATTGGCGGACACTGCCCTGTAGTTTGGGAGATTTGTACX
Edits in Original Sequence 
(5')XGTAGAGAGAAGGXTGCTACATTTACAGAATTCCACGAGGAGGAGGAGGAGGAGAAAACTCTCATATTTAGGCAAATGGGGGTGGA
CTACTATAAAATCCTTCAGGTAGACCGCAATGCCAAAGAAGACGACCTCAAGAGAGCCTATCGCAAACTCGCTATGAAATGGCACCCCGA
TAAAAACCCTAACAATAAAAAGGATGCCGAAGCAAAATTCAAACAAATCTCCGAAGCCTACGATGTGTTGAGTGATCCGCAGAAGAGGGC
AGTATATGACCAGTACGGAGAAGAGGGATTAAAGGGGCAGGTTCCTCCGCCTAGTGCATACGCCTCTACGTCGGATGGGGGTGGTCCCAC
CATGTTCCGGTTCAATCCCCGCAACCCCGATGACATTTTCTCCGAATTCTTTGGGTTCTCGAGTCCCTTTGGGGGAATGGGCGGGATGGA
AAAATATGGGTGGCCCGcGTTCTGCTGGATCAAGCTTCTCCAGAGGTATGTTCAGCGATGATATCTTCGCATCGTTTAGGAGTGCCACCA
GCGAAGGCTCCTCTGGCAGTGTCCCCCGGAAAGGCGCCGCCATTGaGCGGACACTGCCCTGTAGTTTGGGAGATTTGTACX(3')C

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan