ESTScan Details for Unigene SGN-U311977

Score 
471
Direction 
Forward
Predicted Peptide Sequence 
NXLEEQRKRKAIEACSETQAKMDALENELSNIVGLDELKVQLRKWAKGMLLDERRRALGLKVGARRAPHMAFLGNPGTGKTMVARVLGKL
LHMVGILPTDSVTEVQRTDLVGEFVGHTGPKTRRKIQEAEGGILFVDEAYRLIPMQKADDKDYGVEALEEIMSVMDSGKVVVIFAGYSEP
MKRVISSNEGFCRRVTKFFIFNDFSSEDLAKILHLRMTNQVX
Predicted Coding Sequence 
AACXACCTTGAAGAGCAGAGAAAGCGTAAAGCTATTGAAGCATGCAGCGAGACTCAAGCAAAGATGGATGCACTGGAAAATGAGTTATCA
AACATAGTTGGACTAGATGAGCTCAAAGTACAACTCCGAAAATGGGCAAAGGGGATGCTCTTGGATGAGAGGCGACGCGCACTTGGACTA
AAAGTTGGTGCTAGAAGGGCACCTCACATGGCCTTCTTGGGAAATCCTGGAACAGGTAAGACTATGGTAGCACGAGTGCTTGGAAAATTA
CTCCACATGGTTGGAATTCTTCCTACCGACAGTGTAACAGAAGTGCAGCGAACAGATTTAGTTGGGGAGTTTGTGGGTCACACAGGACCA
AAGACAAGGAGAAAGATACAAGAAGCTGAAGGTGGAATTCTTTTCGTGGATGAAGCCTACAGACTCATACCCATGCAGAAGGCAGATGAT
AAAGACTACGGGGTGGAGGCTCTAGAAGAAATAATGTCAGTCATGGATAGTGGAAAAGTTGTTGTAATCTTTGCTGGCTACAGTGAACCA
ATGAAGCGCGTGATTTCTTCAAATGAAGGCTTCTGCAGAAGGGTAACAAAGTTTTTTATTTTTAACGACTTCAGTTCTGAGGATCTTGCC
AAGATTCTTCATCTTAGAATGACTAATCAAGTTGXX
Edits in Original Sequence 
(5')AACXACCTTGAAGAGCAGAGAAAGCGTAAAGCTATTGAAGCATGCAGCGAGACTCAAGCAAAGATGGATGCACTGGAAAATGAGTT
ATCAAACATAGTTGGACTAGATGAGCTCAAAGTACAACTCCGAAAATGGGCAAAGGGGATGCTCTTGGATGAGAGGCGACGCGCACTTGG
ACTAAAAGTTGGTGCTAGAAGGGCACCTCACATGGCCTTCTTGGGAAATCCTGGAACAGGTAAGACTATGGTAGCACGAGTGCTTGGAAA
ATTACTCCACATGGTTGGAATTCTTCCTACCGACAGTGTAACAGAAGTGCAGCGAACAGATTTAGTTGGGGAGTTTGTGGGTCACACAGG
ACCAAAGACAAGGAGAAAGATACAAGAAGCTGAAGGTGGAATTCTTTTCGTGGATGAAGCCTACAGACTCATACCCATGCAGAAGGCAGA
TGATAAAGACTACGGGGTGGAGGCTCTAGAAGAAATAATGTCAGTCATGGATAGTGGAAAAGTTGTTGTAATCTTTGCTGGCTACAGTGA
ACCAATGAAGCGCGTGATTTCTTCAAATGAAGGCTTCTGCAGAAGGGTAACAAAGTTTTTTATTTTTAACGACTTCAGTTCTGAGGATCT
TGCCAAGATTCTTCATCTTAGAATGACTAATCAAGTTGXX(3')GTTGAGAATACCTTGCTGTATGGATTTAAGGTGCCCCCCTCGTGTA
GCATAGATGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan